KEGG   Escherichia coli 55989 (EAEC): EC55989_3289
Entry
EC55989_3289      CDS       T00826                                 

Name
(GenBank) conserved hypothetical protein
  KO
K11902  type VI secretion system protein ImpA
Organism
eck  Escherichia coli 55989 (EAEC)
Brite
KEGG Orthology (KO) [BR:eck00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eck02044]
    EC55989_3289
Secretion system [BR:eck02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EC55989_3289
SSDB
Motif
Pfam: ImpA_N T6SS_VasJ
Other DBs
NCBI-ProteinID: CAU99311
UniProt: B7LFQ6
Position
complement(3378113..3379189)
AA seq 358 aa
MNKIETDTLLLPVIGESPAGDDIEYDPVYSEIREARQNDPDYMSQGEWAVSEPRRADWRK
VRKLCEVTLRNKSKDLQISCWYVESLTHLYALEGMHCGLEYLAKFISQYWTTCWPSQEEG
QEIRYSKLVRLDIDLSEYLKAYPLLEDKEITLSEWYKVLSFEHGASLSEAGKERLIESEG
DHSVESFKRAVGKYNPRKVSEQLLQLYDLPDKIDEIESSYFFHTHEDIHHIFAKTRHIIS
EITELLSRFLPQETLDHSSVSQFLGKPDSRDTRTALPEEKKEFYSALTPSTDKEMSREKA
IEQLEKIAIFFRQSEPTSPVPYLLERAIRWSTMTMSEWLEELLKDNDSMEQINRVLKG
NT seq 1077 nt   +upstreamnt  +downstreamnt
atgaacaaaatagaaacggatacattactgcttcctgttataggagaatcgccggcaggt
gatgatattgagtatgatccggtgtatagcgaaatacgggaggcaagacaaaatgatccg
gactatatgtctcagggggaatgggctgtcagtgaaccccgcagagctgactggagaaaa
gtaagaaaattatgtgaggttactttacgtaataagagtaaggacctacaaattagttgc
tggtatgtggagtccttgacgcatttatatgctctggaagggatgcattgcggattggaa
tatcttgcaaagtttatttctcagtactggactacatgctggccatcgcaggaagaaggt
caggaaattcgttacagtaaattggttcgtcttgatatagatttatcagagtatctgaaa
gcatatcctcttcttgaggataaggaaatcacactttctgaatggtataaggtgttatcg
tttgaacatggagcaagtttgtcagaagctggaaaagaaagattaatagagagcgaaggt
gatcactctgttgagtccttcaaaagagctgtaggaaaatataatccccgcaaggttagt
gagcaacttctccagctttatgatctacctgacaaaattgatgagattgaatcttcttac
ttctttcatacgcatgaagatatacatcatattttcgcaaaaaccagacatatcatcagt
gagataaccgagttactgagtcgttttttgccgcaagaaacactggatcacagttcagtt
tctcaatttctaggcaaacccgatagcagagacacaaggacagcacttcctgaggagaaa
aaggaattttattctgcattaacaccctcaacagataaagagatgtcaagggagaaagct
atagagcaactggagaaaatagctatttttttcaggcaatctgaaccaaccagtcctgtt
ccttatcttctggagagggccatacgttggtcaacaatgactatgtcagaatggcttgag
gaactacttaaagataatgactctatggaacaaataaaccgtgtcttaaaaggatga

DBGET integrated database retrieval system