KEGG   Escherichia coli 55989 (EAEC): EC55989_3298Help
Entry
EC55989_3298      CDS       T00826                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
eck  Escherichia coli 55989 (EAEC)
Brite
KEGG Orthology (KO) [BR:eck00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eck02044]
    EC55989_3298
Secretion system [BR:eck02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EC55989_3298
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VipA
Motif
Other DBs
NCBI-ProteinID: CAU99327
UniProt: B7LFR5
Position
complement(3387122..3387598)
Genome map
AA seq 158 aa AA seqDB search
MSNTQHKLDKTRPPRVQITYDVETGDAETAKELPLVIGVLGEYSSSEKPLRERKFISIDK
DNFDEVMASMSPTAHFMVDSVIPGNEGKLDVELRFSCKDDFSPDNVIQQVECLRKLSELR
LHLCDLRNRAASNEKLKEKLQELLVTTNGNPENDESKE
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatacacaacataaacttgataaaacccgccccccacgagtacagataacgtat
gatgttgaaaccggagatgctgaaactgcgaaagagttaccccttgtcatcggggttttg
ggtgagtactcttcgtcagaaaaaccattgagagaacgaaaattcattagtatagataaa
gacaattttgatgaagttatggcatcaatgagtccgactgctcattttatggtggacagt
gttatcccgggaaatgaaggaaaactggatgtcgaactgaggtttagttgcaaagatgat
ttttctcccgataatgtgattcaacaggttgagtgtctaagaaaattatcggaattgagg
ttgcatctttgtgacctacgaaacagggctgcaagtaatgagaaactgaaagaaaaactt
caggaattgctggtgactactaatggcaatcctgaaaacgatgaaagtaaggaataa

DBGET integrated database retrieval system