KEGG   Escherichia coli 55989 (EAEC): EC55989_3315
Entry
EC55989_3315      CDS       T00826                                 

Name
(GenBank) conserved hypothetical protein
  KO
K11911  type VI secretion system protein VasL
Organism
eck  Escherichia coli 55989 (EAEC)
Brite
KEGG Orthology (KO) [BR:eck00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eck02044]
    EC55989_3315
Secretion system [BR:eck02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EC55989_3315
SSDB
Motif
Pfam: VasL ImpA_N
Other DBs
NCBI-ProteinID: CAU99353
UniProt: B7LFT0
Position
complement(3396575..3397942)
AA seq 455 aa
MTSEVKLKTGGDPRSLPDYAALRDEISKLTHPARPDVDWRYVETLCLRLYEHNGVELQTA
SWYTIARMHTTGLSGLNEGLALIVALTRHHWSVMWPLNTHARLEIITGLFNHLQKTLRAM
PPDDRDNLPLLYQTETFLKALSDTLARHELKQSSKVALPEAMVKGYITRLENQPVQGEVS
SPVTLPAQALRSDAPDVQEHQTLPHSRLVYVVSETKAESGKENTHSLQKSPPTFLKPFVT
GVCAALLAVSVAIPGWQFLTQPSPAEQQLRALLTPPPDVLSAGQMTQLSRTPSLLNHASE
WITLSGQQITRLAELPPAYNLQRSAQLLQQLRVLFPDNPRVQEMVDNWQKSVRSRALPEE
AMAGWNEGMTRLQQLAERLNRLDEQRGKYMTVSELKTEVFGIMQAFNRHIPAEEQLRRYD
EVRNQNSSEQQQKKVENGLVELVSRYWVLTQGDMK
NT seq 1368 nt   +upstreamnt  +downstreamnt
atgacttctgaagtgaaactgaaaaccggtggtgacccccggtcattaccggattatgct
gccctgcgcgatgaaatcagcaaactgactcacccggcacgcccggatgtggactggcgt
tacgtggaaacactctgcctgcgtctgtatgaacacaatggcgtggaattacagacggca
tcctggtacaccatcgcccggatgcatacaacagggttaagtggtctgaatgaagggctg
gctctgattgtggcgctgacccggcatcactggtcagtgatgtggccgctgaatacccac
gcccggctggaaattattaccggtctgttcaaccatctgcaaaaaacgcttcgggccatg
cctccggacgaccgtgacaacctgcccctgctgtatcagaccgaaacattcctgaaggca
ctgagtgacacactggcccggcacgaacttaaacagagcagtaaagtggctttaccggaa
gccatggtgaagggatatatcacccgcctggagaaccagcctgtgcagggtgaagtatcg
tctccggtaacccttccggcgcaggcactccggtctgatgctccggacgtacaggaacat
cagaccctgccgcactcccgtctggtgtatgttgtttctgaaacaaaagcagagagcgga
aaagaaaacacacattcccttcagaaatccccgcccacgtttctgaaaccgtttgtaact
ggtgtctgtgcggcattgctggcggtcagcgtggccattccgggatggcagtttctgaca
cagccatcaccggcggagcagcaactcagggcgttgctgacaccaccaccggatgtgctt
tcagcaggccagatgacacagctcagcagaacaccttcactgctaaatcatgcgtcagag
tggataaccctttccggtcagcagataacacgactggcagaactacccccggcatacaac
ctgcaacgcagtgcgcagctgctgcagcaactgagggtactttttcccgacaatccccgt
gttcaggaaatggtggataactggcagaagagtgtaaggagtcgtgcgctcccggaagag
gcgatggcgggctggaacgaaggcatgacccgcttacagcagctggctgagcgcctgaac
cgtctggatgagcagcggggaaaatacatgacggtcagtgaactgaaaacggaggtgttt
ggcatcatgcaggcttttaaccggcatatcccggcagaagagcagttacgtcgctatgat
gaagttcgtaaccagaatagcagtgaacagcagcaaaaaaaggtggaaaatggtcttgtc
gagctggtgagtcgttactgggttttgacgcaaggggacatgaagtga

DBGET integrated database retrieval system