KEGG   Escherichia coli 55989 (EAEC): EC55989_3325
Entry
EC55989_3325      CDS       T00826                                 

Name
(GenBank) conserved hypothetical protein; putative membrane protein
  KO
K11891  type VI secretion system protein ImpL
Organism
eck  Escherichia coli 55989 (EAEC)
Pathway
eck03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:eck00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    EC55989_3325
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eck02044]
    EC55989_3325
Secretion system [BR:eck02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EC55989_3325
SSDB
Motif
Pfam: IcmF-related IcmF_C
Other DBs
NCBI-ProteinID: CAU99370
UniProt: B7LFU0
Structure
Position
complement(3408374..3411763)
AA seq 1129 aa
MNKLACLSGRFGRPGIVFIGVAALWWLITRYGAYLGAETRRDQILLLILLSLGVLFVCYL
PVMKKYVQELTYRRRARKEQRLPDDEERLAQTPPRYVTVQDIRHTLRRQYGRFWGRKIRI
LLITGTASEVELLTPGLTEQFWQEEQGTLLLWGGDPSQPENADWLAALRRLRYRPADGIV
WVTSGLSETLSAPLTEDALDRVSRAVSSCCERLGWRLPLYVWSLQESPDERGRITQPVGC
LLPAECSSDKLKAQLQAMLPGLVAQGIQQICCAPRYYFLLSLAERFRRNIDAVVEPLSVL
LRPYRQLLLAGIVFSPATVGGERSVRHRWRMDNRWEALPETVQQLPVRLQPSRTGHNWRR
SLAVMAAILMMAQGTGMVVSFLANRSLVAEVQEQIRPAQNQQLSPAERLQALLNLQKSLA
RLQYREEHGAPWYLRAGMNQNADLLAVVMPLYAQNAHLLLRDAAAAHLEQQLRTFIRLPP
DSPQRGKMAKAAYDQLRLYLMLAQPQHMEPAWFSRTLMREWPQRDGVSAVFWQANGPTLL
AYYASGIITHPQWKLTADEELVSQSRTLLLRHLGTQNSDAMLYQKMLARVAHQFADMRLT
DMTGDTDVSRLFFTDEVVPGMFTRQAWEEAVLPSIDTVINERREEMDWVLTDGRQKAPSP
VSPEALRQRLTTRYFADFGNAWLNFLNSLHLRKAQTLSDVTEQLTLMADVRQSPLVALMN
TLAVQGCTGQPREAVTDSLVKSARNLLSQEKQPVAVPESRLHGPLATTFGPVLALMDNQN
NSADMLNLQTYLTRVTQVRLRLQQIAGSSDPQAMMQLLAQTVLQGKSVDLTDTRDYGSLT
AAGLGQEWYGFGQTVFVRPMEQAWQQVLTPAAESLNARWRTAVVDGWNNAFSGRYPFKNV
SSDASLPLLAKYLNTDTGRIARFLQNNLSGVLHREGSRWVPDTINTRGLTFNPAFLKAIN
TLSEIADVAFTTGNAGLHFELRPGTAAGVMQTTLITDNQKLIYVNQMPVWKRFTWPADTE
APGASLSWVSTQAGTRQYADLPGSWGLIRLLEMARRKAAPGVASGWSLSWQAQDGRMLNY
TLRTEAGEGPLVLLKLRNFVLPETVFELSGTSAFTGNDEDAGDTVEETD
NT seq 3390 nt   +upstreamnt  +downstreamnt
atgaataaactggcctgtctgtctggtcgctttgggcgaccggggattgtatttattggt
gtggctgcgctctggtggctgataacccgatatggagcatatctgggggcagaaacacgc
cgggatcaaatactactgctgatattgctgagtctgggggtgctctttgtctgttacctg
cctgtgatgaaaaaatatgttcaggaactgacatatcgacgcagggcccgtaaggagcaa
aggttacctgacgatgaagagcgattggctcagacgccaccgcgctatgttactgttcag
gatattcgtcatactctgcggcgccagtatggcagattctggggacgtaagatacgcatt
ctgttgataacaggtaccgcctctgaggttgagttgttgaccccgggcctgacagaacag
ttctggcaggaagagcaggggacattgcttctctggggaggagacccctcgcagccggaa
aacgcagactggctggctgcgttacgccgtctgcgttaccggcctgctgatggcattgtc
tgggtaacttccggactgagtgaaacattatccgcaccactgacagaagatgccctggac
agggtttcccgtgcggtcagttcatgttgtgagcgccttggctggcgtctgccgctgtat
gtctggtcactgcaggagagtccggatgagcgagggcgtattactcagcccgtgggatgc
cttctgccagcagaatgtagttctgacaaactgaaagcacaactacaggccatgctcccc
gggcttgttgctcaggggatacagcagatatgctgtgcccctcggtattattttttgttg
tcgctggcagagcgattcagacgaaatattgatgctgtggtggagccattatccgtatta
ctccgtccataccgtcagttgttgctggcgggtattgttttcagtccggcaactgtcggc
ggtgaacgaagtgtcagacatcgctggcgaatggataaccgctgggaggcgttgccggag
acagtgcagcaattacctgtccggctacagccttcccgcacaggtcataactggcgcaga
agtctggccgttatggcggccatactgatgatggctcagggaacaggaatggtggtttcc
tttctggcaaaccggagtctggttgctgaagtacaggaacagattcgtccggctcagaac
cagcaactgtctcctgcagaacgtctgcaggcgttgctgaatctgcagaaatccctggcc
cgccttcagtaccgggaggagcacggggcgccatggtacctgcgggccggtatgaatcag
aatgcagacctgctcgcggtcgtaatgcccctttatgcacaaaatgcacatcttttactg
cgtgatgccgctgctgctcatcttgagcagcagctcaggacatttattcgtcttcctccg
gacagcccgcagcgggggaaaatggcaaaagccgcatatgaccagctcagactgtatctg
atgctggcgcaaccgcaacatatggagcccgcctggttcagtcgtacgctcatgcgggaa
tggccacagcgtgacggtgtgagtgccgttttctggcaggctaatggcccgacgttgctg
gcgtattatgcctccgggattattactcatcctcagtggaagctgacggctgatgaagag
ctggtcagccagagcagaactctgctgcttcgccatctgggaacacagaacagcgatgcc
atgctgtatcagaaaatgctggcacgggtggcacatcagtttgcggatatgcgtctgacg
gatatgaccggtgatactgatgtctcccgcctcttttttacggatgaagtggttcccggt
atgtttacccgccaggcctgggaagaggccgtattgccgtcgatagacaccgtgattaat
gagcgtcgtgaagaaatggactgggtactgacggatggcaggcagaaggcaccgtcaccg
gtatcgccggaagcactcagacagcgcctgacaacgcgctattttgctgattttggtaat
gcctggctgaattttctgaacagtctgcacttgcgtaaagctcagacgctgtctgatgtg
acagagcaactgacgcttatggctgatgtgcgccagtcccccctggttgctctgatgaat
acgctggcggttcaggggtgtactggccagccccgggaagcggttactgattcactggtt
aaatctgccagaaacctgctttcacaggaaaaacagccagtggcagtaccggaaagccgg
cttcacggtcctctggcgacgactttcgggccggtgcttgcactgatggataatcagaac
aacagtgcggatatgctgaatctgcagacatatctgacccgggtgacacaggttcgtctg
cgtctgcaacagattgccggctcttctgacccgcaggccatgatgcagttgctggcacag
acagtattgcaggggaaatcggttgatttaaccgatacccgggattacggcagcctgacc
gctgccggactcggacaggagtggtatggcttcggacagacggtctttgttcgcccgatg
gagcaggcgtggcagcaggttcttacgcccgcggcagaaagtctgaatgcccggtggcgt
actgcggtggtggatggctggaataatgcattttccgggcgttatccgtttaaaaatgtc
agcagcgatgcttcgcttcccctgctggcaaaatacctgaatacggacacgggacgtatt
gcccgtttcctgcagaataacctgagtggtgtgttgcacagggaaggcagtcgctgggta
cctgataccattaatacccggggactgacattcaaccctgcgtttctgaaagccatcaat
accctgagtgaaatagcggatgtggcgttcaccacaggtaacgcggggctgcattttgag
ctgcgcccgggaactgctgccggtgtgatgcagacgacgctgataaccgataatcagaaa
ctgatttatgttaatcagatgccggtatggaagcgatttacctggccggctgatacggaa
gcacctggcgccagtttaagctgggtaagcactcaggccggtacccgtcagtatgcagac
ctgccgggaagctgggggctgatacgtctgcttgagatggcccgacggaaagccgcaccg
ggcgttgccagtggctggagcctgagctggcaggcgcaggacggtcgtatgctgaattac
acactgcgaactgaagcgggggaagggccgcttgtattgctgaaactccgcaattttgtt
ctgccggaaacggttttcgaactctccggcacgtcagcgtttacaggcaatgacgaagat
gccggggataccgtggaggagactgactga

DBGET integrated database retrieval system