KEGG   Escherichia coli 55989 (EAEC): EC55989_3335Help
Entry
EC55989_3335      CDS       T00826                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
eck  Escherichia coli 55989 (EAEC)
Pathway
eck03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:eck00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    EC55989_3335
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eck02044]
    EC55989_3335
Secretion system [BR:eck02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EC55989_3335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP
Motif
Other DBs
NCBI-ProteinID: CAU99385
UniProt: B7LG67
Structure
PDB: 

Position
complement(3422840..3423331)
Genome map
AA seq 163 aa AA seqDB search
MAIPVYLWLKDDGGADIKGSVDVQDREGSIEVVAQEHCLYIPTDNNTGKLTGTRIHTPFL
FTKEIDSSSPYLYKAVTTGQTLKSAEFKWYKINDAGQEVEYFNTKLENVKVVKVNPVMHD
IKNPAYEKHNHLEQVELRYEKITWTYKDGNIIHSDAWSERTTA
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atggcaattccagtttatctgtggctgaaagatgatggcggtgcagatatcaaagggtcc
gtggatgttcaggaccgtgagggcagcattgaggtggtggctcaggagcactgcctctac
atcccgacggataacaataccggtaagctgaccggtacccgtattcacacgccgtttctg
tttaccaaggaaattgattcttccagcccgtacctttacaaggccgtgaccaccgggcag
accctgaagtctgctgagtttaagtggtacaaaatcaatgatgccggtcaggaggtggag
tatttcaatacgaagcttgagaacgtgaaggtggtgaaggttaacccggtcatgcacgac
atcaagaatcccgcttacgagaagcataaccaccttgagcaggtggaactgcgctacgag
aaaatcacctggacttacaaggacggcaacatcattcattccgacgcatggagtgagcgt
accaccgcgtaa

DBGET integrated database retrieval system