KEGG   Escherichia coli 55989 (EAEC): EC55989_4104Help
Entry
EC55989_4104      CDS       T00826                                 

Gene name
dfp
Definition
(GenBank) fused 4'-phosphopantothenoylcysteine decarboxylase; phosphopantothenoylcysteine synthetase, FMN-binding
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
eck  Escherichia coli 55989 (EAEC)
Pathway
eck00770  Pantothenate and CoA biosynthesis
eck01100  Metabolic pathways
Module
eck_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:eck00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    EC55989_4104 (dfp)
Enzymes [BR:eck01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     EC55989_4104 (dfp)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     EC55989_4104 (dfp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein PALP
Motif
Other DBs
NCBI-ProteinID: CAV00644
UniProt: B7L762
Structure
PDB: 

Position
4187753..4188973
Genome map
AA seq 406 aa AA seqDB search
MSLAGKKIVLGVSGGIAAYKTPELVRRLRDRGADVRVAMTEAAKAFITPLSLQAVSGYPV
SDSLLDPAAEAAMGHIELGKWADLVILAPATADLIARIAAGMANDLVSTICLATPAPVAV
LPAMNQQMYRAAATQHNLEVLASRGMLIWGPDSGSQACGDIGPGRMLDPLTIVDMAVAHF
SPVNDLKHLNIMITAGPTREPLDPVRYISNHSSGKMGFAIAAAAARRGANVTLVSGPVSL
PTPPFVKRVDVMTALEMEAAVNASVQQQNIFIGCAAVADYRAATVAPEKIKKQATQGDEL
TIKMVKNPDIVAGVAALKDHRPYVVGFAAETNNVEEYARQKRIRKNLDLICANDVSQPTQ
GFNSDNNALHLFWQDGDKVLPLERKELLGQLLLDEIVTRYDEKNRR
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgagcctggccggtaaaaaaatcgttctcggcgttagcggcggtattgctgcctataaa
acccctgaactggtgcgtcgtttgcgcgatcgcggggccgacgtccgcgtagccatgacc
gaagcggcaaaagcctttatcaccccacttagcttgcaggcggtttctggttatcccgtt
tccgacagtctgctggacccggcagccgaagccgctatgggccatattgagctgggtaaa
tgggctgatttagtgattctcgcccctgccacggcagatttgattgcccgtattgctgcc
ggaatggcgaatgacctggtatcgacgatttgtctggctacacctgcgcctgtagccgtg
ctccccgccatgaaccagcagatgtaccgtgccgctgccacgcagcataatttagaggtg
cttgcttcccgtggtatgctcatctgggggccagacagtggcagtcaggcttgtggtgat
atcggtcctgggcgaatgctcgatccgttaaccattgtggatatggcggtggcgcatttt
tcgcccgtcaacgacctgaaacatctgaacattatgattaccgccggcccgacgcgtgaa
ccgctcgatccggtgcgttatatctctaatcacagctccggcaagatgggttttgctatc
gccgccgccgctgcccgtcgtggcgcgaacgtcacgctggtatcaggtccggtttcacta
ccgacgccaccgtttgttaaacgtgttgatgtgatgactgcgctggaaatggaagccgcc
gtgaatgcttctgtacagcagcaaaatatttttatcggttgcgccgccgtggcggattat
cgcgcagctaccgtggccccagagaaaatcaaaaagcaggccacgcagggtgatgaatta
acaataaaaatggttaaaaaccccgatatcgtcgcaggcgttgccgcactaaaagaccat
cgaccctacgtcgttggatttgccgccgaaacaaataatgtggaagaatacgcccggcaa
aaacgtatccgtaaaaaccttgatctgatctgcgcgaacgatgtttcccagccaactcaa
ggatttaacagcgacaacaacgcattacaccttttctggcaggacggagataaagtctta
ccgcttgagcgcaaagagctccttggccaattattactcgacgagatcgtgacccgttat
gatgaaaaaaatcgacgttaa

DBGET integrated database retrieval system