KEGG   Escherichia coli 55989 (EAEC): EC55989_4787Help
Entry
EC55989_4787      CDS       T00826                                 

Gene name
ytfR
Definition
(GenBank) putative sugar transporter subunit: ATP-binding component of ABC superfamily
  KO
K10820  galactofuranose transport system ATP-binding protein [EC:7.5.2.9]
Organism
eck  Escherichia coli 55989 (EAEC)
Pathway
eck02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:eck00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    EC55989_4787 (ytfR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eck02000]
    EC55989_4787 (ytfR)
Enzymes [BR:eck01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.9  ABC-type D-galactofuranose transporter
     EC55989_4787 (ytfR)
Transporters [BR:eck02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Galactofuranose transporter
    EC55989_4787 (ytfR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 AAA_23 AAA_30 AAA_16 RsgA_GTPase ABC_ATPase AAA_22 MMR_HSR1 DUF2813 AAA_15 TsaE DUF815 DLIC AAA_27
Motif
Other DBs
NCBI-ProteinID: CAV01749
UniProt: B7LCT9
Position
4897900..4899402
Genome map
AA seq 500 aa AA seqDB search
MTTDQHQEILRTEGLSKFFPGVKALDNVDFSLRRGEIMALLGENGAGKSTLIKALTGVYH
ADRGTIWLEGQAISPKNTAHAQQLGIGTVYQEVNLLPNMSVADNLFIGREPKRFGFLRRK
EMEKRATELMTSYGFSLDVREPLNRFSVAMQQIVAICRAIDLSAKVLILDEPTASLDTQE
VELLFGLMRQLRDRGVSLIFVTHFLDQVYQVSDRITVLRNGSFVGCRETRELPQIELVKM
MLGRELDTHALQRAGRTLLSDKPVAAFKNYGKKGTIAPFDLEVRPGEIVGLAGLLGSGRT
ETAEVIFGIKPADSGTALIKGKQQNLRSPHQASVLGIGFCPEDRKTDGIIAAASVRENII
LALQAQRGWLRPISRKEQQEIAERFIRQLGIRTPSTEQPIEFLSGGNQQKVLLSRWLLTR
PQFLILDEPTRGIDVGAHAEIIRLIETLCADGLALLVISSELEELVGYADRVIIMRDRKQ
VAEIPLAELSVPAIMNAIAA
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccgaccaacaccaggaaatcctccgcaccgaaggattaagtaaatttttcccc
ggcgtcaaagcgttagacaacgttgatttcagcctgcgccgtggcgaaatcatggcgctg
ctcggtgaaaacggggcgggaaaatcgacgctaatcaaagcattaaccggtgtataccac
gccgatcgcggcaccatctggctggaaggccaggctatctcaccgaaaaataccgcccat
gcacaacaactcggcatcggaaccgtttatcaggaagtcaacctgctacccaatatgtcg
gtcgctgataatctattcataggtcgcgaacccaaacgtttcggctttctacgccgcaaa
gagatggaaaagcgtgccaccgaactgatgacatcttacggtttctccctcgacgtgcgt
gaaccgcttaaccgtttttcggtggcgatgcagcaaatcgtcgccatttgccgggctatc
gatctctccgccaaagtgctgatcctcgatgaacccaccgccagcctcgacacccaggaa
gtagagttactgtttggcctgatgcgtcagttgcgcgatcgcggcgtcagcctgatcttt
gtcactcactttctcgatcaggtctatcaggtcagcgatcggatcaccgtcttacgcaac
ggcagtttcgtaggctgtcgggaaacgcgcgagctaccgcagatcgaactggtaaaaatg
atgctggggcgcgagctggatacccacgcgctacagcgtgccgggcgaacattgttgagc
gacaaacccgttgccgcgttcaaaaattacggcaaaaaaggaacgatcgcaccgtttgat
ctcgaagtacgccccggcgagatcgtcggcctggcaggcttgctgggatccggacgtacc
gaaaccgccgaagtgatcttcggtatcaaacctgctgacagcggcacggcgttgatcaaa
ggcaaacagcaaaacctgcgatcgccacatcaggcttcggtactgggcatcggcttctgc
ccggaagacaggaaaaccgatggcatcatcgccgccgcctcggtacgggaaaatatcatc
ctcgctctccaggcccagcgcggctggctacgacccatttcccgcaaagagcagcaagag
attgccgaacgctttatccgccagcttggcattcgcacaccttcaactgaacaaccgatt
gaatttctctctggcggcaatcagcaaaaagtgttgctttcacgttggctactgacccga
ccgcaatttctgatcctcgacgagccaacccgcggcattgatgttggtgcccacgccgag
atcatccgcctgattgaaacgctgtgtgctgacggtctggcgctgttggtgatctcctcc
gaactggaagagctggtgggctatgccgatcgggtgattatcatgcgcgatcgcaaacag
gtggcggagatcccgctggcagagctttccgttccggcgatcatgaacgccattgcggcg
taa

DBGET integrated database retrieval system