KEGG   Escherichia coli ATCC 8739: EcolC_0840
Entry
EcolC_0840        CDS       T00697                                 

Definition
(GenBank) (2Fe-2S)-binding domain protein
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
ecl  Escherichia coli ATCC 8739
Pathway
ecl00230  Purine metabolism
ecl01100  Metabolic pathways
ecl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ecl00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    EcolC_0840
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: ACA76512
Position
complement(908775..909254)
AA seq 159 aa
MNHSETITIECTINGMPFQLHAAPGTPLSELLREQGLLSVKQGCCVGECGACTVLVDGTA
IDSCLYLAAWAEGKEIRTLEGEAKGGKLSHVQQAYAKSGAVQCGFCTPGLIMATTAMLAK
PREKPLTITEIRRGLAGNLCRCTGYQMIVNTVLDCEKTK
NT seq 480 nt   +upstreamnt  +downstreamnt
atgaatcacagcgaaacaattaccatcgaatgcaccattaacgggatgccttttcagctt
cacgccgcaccaggcacgccgctctcggaattactccgcgaacaaggactgctaagtgtc
aaacaagggtgctgcgtgggtgaatgtggtgcctgtacggtgttggtcgacggcacagca
atagacagttgcttataccttgccgcctgggctgaaggaaaagagatccgcacgctggaa
ggtgaagcgaaaggcggaaaactttctcatgttcagcaggcttatgcgaaatccggcgca
gtgcagtgcgggttttgtacgcctggcctgattatggctaccacggcaatgctggcgaaa
ccacgcgagaagccattaaccattacggaaattcgtcgcggactggcgggaaatctttgt
cgctgcacggggtatcagatgattgtaaatacagttctggattgcgagaaaacgaagtaa

DBGET integrated database retrieval system