KEGG   Escherichia coli ATCC 8739: EcolC_0871Help
Entry
EcolC_0871        CDS       T00697                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ecl  Escherichia coli ATCC 8739
Pathway
ecl00071  Fatty acid degradation
ecl00280  Valine, leucine and isoleucine degradation
ecl00310  Lysine degradation
ecl00362  Benzoate degradation
ecl00380  Tryptophan metabolism
ecl00620  Pyruvate metabolism
ecl00630  Glyoxylate and dicarboxylate metabolism
ecl00640  Propanoate metabolism
ecl00650  Butanoate metabolism
ecl00900  Terpenoid backbone biosynthesis
ecl01100  Metabolic pathways
ecl01110  Biosynthesis of secondary metabolites
ecl01120  Microbial metabolism in diverse environments
ecl01130  Biosynthesis of antibiotics
ecl01200  Carbon metabolism
ecl01212  Fatty acid metabolism
ecl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ecl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    EcolC_0871
   00630 Glyoxylate and dicarboxylate metabolism
    EcolC_0871
   00640 Propanoate metabolism
    EcolC_0871
   00650 Butanoate metabolism
    EcolC_0871
  09103 Lipid metabolism
   00071 Fatty acid degradation
    EcolC_0871
   00072 Synthesis and degradation of ketone bodies
    EcolC_0871
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EcolC_0871
   00310 Lysine degradation
    EcolC_0871
   00380 Tryptophan metabolism
    EcolC_0871
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    EcolC_0871
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    EcolC_0871
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    EcolC_0871
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecl04147]
    EcolC_0871
Enzymes [BR:ecl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     EcolC_0871
Exosome [BR:ecl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EcolC_0871
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III DUF3103
Motif
Other DBs
NCBI-ProteinID: ACA76540
Position
935111..936292
Genome map
AA seq 393 aa AA seqDB search
MKDVVIVGALRTPIGCFRGALAGHSAVELGSLVVKALIERTGVPAYAVDEVILGQVLTAG
AGQNPARQSAIKGGLPNSVSAITINDVCGSGLKALHLATQAIQCGEADIVIAGGQENMSR
APHVLTDSRTGAQLGNSQLVDSLVHDGLWDAFNDYHIGVTAENLAREYGISRQLQDAYAL
SSQQKARAAIDAGRFKDEIVPVMTQSNGQTLVVDTDEQPRTDASAEGLARLNPSFDSLGS
VTAGNASSINDGAAAVMMMSEAKARALNLPVLARIRAFASVGVDPALMGIAPVYATRRCL
ERVGWQLADVDLIEANEAFAAQALSVGKMLEWDERRVNVNGGAIALGHPIGASGCRILVS
LVHEMVKRNARKGLATLCIGGGQGVALTIERDE
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacgttgtgattgtcggggcgttacggacacctatcggctgctttcgcggtgcg
ttagcgggtcattccgccgtggaacttggtagtctggtcgtgaaagcgttaatagaacgt
accggcgttcctgcatatgcggtggatgaagtaattcttggtcaggtgttgactgcaggg
gcagggcagaatccggcaaggcaatcggctattaaaggtggtctgcctaatagcgtttct
gcaatcacgattaatgacgtctgcggttccggacttaaagcactgcatctggctactcag
gcgatacagtgtggcgaggctgatattgtcatcgccggtggccaggaaaacatgagccgc
gcaccacatgttctgactgatagccgcaccggtgcacagcttggcaatagccagctggtt
gacagtcttgtgcatgatgggttatgggatgccttcaatgattatcatattggtgtcacc
gccgaaaatctggctcgcgaatatggcatcagccgtcaattgcaggatgcttacgcactt
agctcgcaacaaaaagcgcgagcggcgattgacgccggacgatttaaagatgagatcgtc
ccggtaatgacccaaagtaacggtcagacgttggttgttgataccgatgaacagccacgc
actgacgccagtgcagaaggtttagcccgtttaaatccttcatttgatagtctcggttct
gtgacagcgggtaatgcatcatccataaacgatggcgcagctgcggtaatgatgatgagc
gaagccaaagcacgagcgttgaatttacccgtgctggcccgcattcgcgcatttgccagc
gttggtgtagatccggcattgatgggaattgcgccggtgtatgcgacccgccgttgcctg
gagcgtgtaggctggcagttggctgatgtcgatcttatcgaggctaatgaagcgtttgct
gcacaggcgctttcggttggcaagatgcttgagtgggatgagcgtcgggtcaatgtcaat
ggtggtgcgatcgcacttggtcacccgataggcgcttccggttgccgaatcctggtttct
ctggttcatgaaatggtgaaacgtaatgcccgcaaaggactggcaacgctttgtatcggc
gggggccagggtgtggcattgaccattgaacgtgacgaatag

DBGET integrated database retrieval system