KEGG   Escherichia coli ATCC 8739: EcolC_0893Help
Entry
EcolC_0893        CDS       T00697                                 

Definition
(GenBank) exodeoxyribonuclease V, gamma subunit
  KO
K03583  exodeoxyribonuclease V gamma subunit [EC:3.1.11.5]
Organism
ecl  Escherichia coli ATCC 8739
Pathway
ecl03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ecl00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    EcolC_0893
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ecl03400]
    EcolC_0893
Enzymes [BR:ecl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     EcolC_0893
DNA repair and recombination proteins [BR:ecl03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     EcolC_0893
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Exonuc_V_gamma RecC_C
Motif
Other DBs
NCBI-ProteinID: ACA76562
Structure
PDB: 

Position
958277..961645
Genome map
AA seq 1122 aa AA seqDB search
MLRVYHSNRLDVLEALMEFIVERERLDDPFEPEMILVQSTGMAQWLQMTLSQKFGIAANI
DFPLPASFIWDMFVRVLPEIPKESAFNKQSMSWKLMTLLPQLLEREDFTLLRHYLTDDSD
KRKLFQLSSKAADLFDQYLVYRPDWLAQWETGHLVEGLGEAQAWQAPLWKALVEYTHQLG
QPRWHRANLYQRFIETLESATTCPPGLPSRVFICGISALPPVYLQALQALGKHIEIHLLF
TNPCRYYWGDIKDPAYLAKLLTRQRRHSFEDRELPLFRDSENAGQLFNSDGEQDVGNPLL
ASWGKLGRDYIYLLSDLESSQELDAFVDVTPDNLLHNIQSDILELENRAVAGVNIEEFSR
SDNKRPLDPLDSSITFHVCHSPQREVEVLHDRLLAMLEEDPTLTPRDIIVMVADIDSYSP
FIQAVFGSAPADRYLPYAISDRRARQSHPVLEAFISLLSLPDSRFVSEDVLALLDVPVLA
ARFDITEEGLRYLRQWVNESGIRWGIDDDNVRELELPATGQHTWRFGLTRMLLGYAMESA
QGEWQSVLPYDESSGLIAELVGHLASLLMQLNIWRRGLAQERPLEEWLPVCRDMLNAFFL
PDAETEAAMTLIEQQWQAIIAEGLGAQYGDAVPLSLLRDELAQRLDQERISQRFLAGPVN
ICTLMPMRSIPFKVVCLLGMNDGVYPRQLAPLGFDLMSQKPKRGDRSRRDDDRYLFLEAL
ISAQQKLYISYIGRSIQDNSERFPSVLVQELIDYIGQSHYLPGDEALNCDESEARVKAHL
TCLHTRMPFDPQNYQPGERQSYAREWLPAASQAGKAHSEFVQPLPFTLPETVPLETLQRF
WAHPVRAFFQMRLQVNFRTEDSEIPDTEPFILEGLSRYQINQQLLNALVEQDDAERLFRR
FRAAGDLPYGAFGEIFWETQCQEMQQLADRVIACRQPGQSMEIDLACNGVQITGWLPQVQ
PDGLLRWRPSLLSVAQGMQLWLEHLVYCASGGNGESRLFLRKDGEWRFPPLAAEQALHYL
SQLIEGYREGMSAPLLVLPESGGAWLKTCYDAQNDAMLDDDSTLQKARTKFLQAYEGNMM
VRGEGDDIWYQRLWRQLTPETMEAIVEQSQRFLLPLFRFNQS
NT seq 3369 nt NT seq  +upstreamnt  +downstreamnt
atgttaagggtctaccattccaatcgtctggacgtgctggaagcgttgatggagtttatt
gtcgaacgcgaacggctggacgatcctttcgaaccagagatgattctggtgcaaagtacc
ggtatggcacagtggctgcaaatgaccctgtcgcaaaagtttggtattgcggcaaacatt
gattttccgctgccagcgagctttatctgggatatgttcgtccgggtgttaccggaaatc
cccaaagagagcgcctttaacaaacagagcatgagctggaaactgatgactctgctgccg
caattgctggagcgcgaagactttaccctgttgcggcattatctgactgacgatagcgac
aagcgaaaactgttccagctttcctcaaaagcggcggacctgtttgaccagtatctggtc
tatcgtccggactggctggcacagtgggaaacaggacatttggttgaagggctgggagaa
gcacaggcctggcaagccccgttgtggaaggcgctggtggaatatacccatcaactcggg
caaccgcgctggcaccgcgccaatctctatcagcgctttatcgaaacgctggagtccgcg
acgacctgcccgccggggttaccttcgcgcgtctttatatgcggtatttccgcgttaccg
cctgtttatctccaggcgctacaggcgctgggtaaacatattgaaatccatctcctgttt
accaacccctgccgttattactggggcgatattaaagatcctgcttatctggcgaaactg
ctgacccgtcagcgtcgacacagttttgaagatcgcgaattgccgctatttcgtgatagc
gaaaatgccgggcagctctttaacagcgatggtgaacaggatgtcggcaacccgctgctg
gcttcatggggtaagcttgggcgcgactacatttatctcctttctgacctggagagcagc
caggagctggacgcctttgtcgatgtcacgccagataacctgctgcataacattcagtct
gacattctggaactggaaaaccgcgccgttgctggtgtgaacatcgaagagttttcccgt
agcgataacaaacgcccgcttgatccactggatagcagtatcaccttccacgtttgccat
agcccgcagcgtgaagttgaagttttacacgatcgcctgctggcgatgctggaggaagac
ccgacgcttactccgcgcgacatcatcgtgatggtggctgatatcgacagctacagtccg
tttattcaggctgtgtttggtagcgcacctgcggatcgttacctaccttacgccatttcc
gaccgtcgtgcgcggcagtcacatccggtactggaagcgtttatcagcctgttatcactg
cctgacagtcgttttgtgtcagaggatgtgctggcgttgctggatgtgccggtgctggcg
gcgcggtttgacatcaccgaagaagggctgcgttatttacgccagtgggtcaacgaatcc
ggcattcgttggggcatagatgacgacaacgttcgcgagctggaactccccgccaccgga
caacacacctggcgatttggcctgacgcgtatgttgttgggctacgcgatggagagcgcg
cagggcgagtggcaatcggttctaccttatgatgaatcgagcggcttaattgcagaactg
gtggggcatctggcttcactgctaatgcagctaaacatctggcgtcgcgggctggcacag
gagcgtccgctggaagagtggttgccggtttgtcgcgatatgctcaacgccttcttcctg
ccggatgcggaaaccgaagcggcgatgacgctgatcgaacaacaatggcaggcgattatc
gccgaaggtttaggtgcgcagtatggcgacgcggtgccgctgtcactattgcgtgatgaa
ctggcacagcgtctggatcaagaacgtatcagccagcgttttctcgccggaccggttaac
atttgtactctgatgccaatgcgttcaattccgttcaaagtggtttgcctgctgggaatg
aacgacggcgtttatccacgtcagcttgcgccattgggctttgacctgatgagccagaaa
ccgaagcgtggcgaccgtagccgtcgcgatgacgaccgctatctgttcctggaagcgtta
atttccgcgcagcaaaaactctatatcagctatatcggtcgttccattcaggataacagt
gagcgtttcccgtcggtactggtgcaggaactgatcgactacatcgggcaaagtcattat
ctaccgggcgatgaagcgctcaactgtgatgaaagcgaggcaagggtaaaagcgcatctt
acttgcctccatacccggatgccgtttgatccgcaaaactaccagccaggcgaacgacaa
agctatgctcgtgaatggctacctgcggccagccaggctggtaaagcacattctgaattt
gttcagccgctgccgtttaccttaccggaaaccgtgccgctggaaacgctacaacgattc
tgggcacatccggtgcgggcgttcttccagatgcgtttgcaggtgaacttccgtactgaa
gacagcgaaatcccagacaccgagccatttattctggaagggcttagccgttatcaaatc
aatcagcagttattgaatgcactggttgagcaggatgatgccgaacgcttgttccgccgc
ttccgggcggcaggggatttaccgtatggcgcttttggtgaaattttctgggaaacacag
tgccaggagatgcagcagcttgccgacagagtcattgcctgtcgccagccggggcagagt
atggaaattgatctcgcctgcaacggtgtgcagataactggctggttgccgcaggtgcag
ccggatggcctgttgcgctggcgtccctctttattaagtgtggcgcagggaatgcaactt
tggctggaacaccttgtctactgtgccagcggtggtaatggtgaaagtcgcctttttcta
cgcaaagacggcgagtggcgttttccgccgcttgcagccgaacaggctttgcattacctc
tcacaactgattgaggggtatcgtgaagggatgtccgcgccattgctggtgttacctgaa
agtggcggcgcgtggctaaaaacctgttatgacgcgcaaaacgatgccatgctggatgac
gattccacgttgcaaaaagcccgtacgaaattccttcaggcttacgaaggcaacatgatg
gtgcgtggcgaaggtgatgatatctggtatcaaaggctctggcggcaattaacaccagag
acaatggaggccatcgttgaacagtcgcaacgtttcctgttaccgctgtttcgctttaat
cagtcatga

DBGET integrated database retrieval system