KEGG   Escherichia coli ATCC 8739: EcolC_1312Help
Entry
EcolC_1312        CDS       T00697                                 

Definition
(GenBank) fatty acid oxidation complex, alpha subunit FadJ
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
ecl  Escherichia coli ATCC 8739
Pathway
ecl00071  Fatty acid degradation
ecl00280  Valine, leucine and isoleucine degradation
ecl00281  Geraniol degradation
ecl00310  Lysine degradation
ecl00362  Benzoate degradation
ecl00380  Tryptophan metabolism
ecl00410  beta-Alanine metabolism
ecl00640  Propanoate metabolism
ecl00650  Butanoate metabolism
ecl00903  Limonene and pinene degradation
ecl00930  Caprolactam degradation
ecl01040  Biosynthesis of unsaturated fatty acids
ecl01100  Metabolic pathways
ecl01110  Biosynthesis of secondary metabolites
ecl01120  Microbial metabolism in diverse environments
ecl01130  Biosynthesis of antibiotics
ecl01200  Carbon metabolism
ecl01212  Fatty acid metabolism
Module
ecl_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ecl00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    EcolC_1312
   00650 Butanoate metabolism
    EcolC_1312
  Lipid metabolism
   00071 Fatty acid degradation
    EcolC_1312
   01040 Biosynthesis of unsaturated fatty acids
    EcolC_1312
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EcolC_1312
   00310 Lysine degradation
    EcolC_1312
   00380 Tryptophan metabolism
    EcolC_1312
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    EcolC_1312
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    EcolC_1312
   00281 Geraniol degradation
    EcolC_1312
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    EcolC_1312
   00930 Caprolactam degradation
    EcolC_1312
Enzymes [BR:ecl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     EcolC_1312
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     EcolC_1312
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     EcolC_1312
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: ACA76978
UniProt: B1IXA5
Position
1441710..1443854
Genome map
AA seq 714 aa AA seqDB search
MEMASAFTLNVRLDNIAIITIDVPDEKMNTLKAEFASQVRAIIKQLRENKELRGVVFISA
KPDNFIAGADINMIGNCKTAQEAEALARQGQQLMAEIHALPIPVIAAIHGACLGGGLELA
LACHGRVCTDDPKTVLGLPEVQLGLLPGSGGTQRLPRLIGVSTALEMILTGKQLRAKQAL
KLGLVDDVVPHSILLEAAVELVKQDRPSSRPLPVRERILAGPLGRALLFKMVGKKTEHKT
QGNYPATERILEVVETGLAQGTSSGYDAEARAFGELAMTPQSQALRSIFFASTDVKKDPG
SDAPPAPLNSVGILGGGLMGGGIAYVTACKAGLPVRIKDINPQGINHALKYSWDQLEGKV
RRRHLKASERDKQLALISGTTDYRGFAHRDLIIEAVFENLELKQQMVAEVEQNCAAHTIF
ASNTSSLPIGDIAAHATRPEQVIGLHFFSPVEKMPLVEIIPHAGTSAQTIATTVKLAKKQ
GKTPIVVRDKAGFYVNRILAPYINEAIRMLTEGERVEHIDAALVKFGFPVGPIQLLDEVG
IDTGTKIIPVLEAAYGERFSAPANVVSSILNDDRKGRKNGRGFYLYGQKGRKSKKQVDPA
IYPLIGAQGQGRLSAPQVAERCVMLMLNEAVRCVDEQVIRSVRDGDIGAVFGIGFPPFLG
GPFRYIDSLGAGEVVAIMQRLATQYGSRFTPCERLVEMSKRGESFWKTTATDLQ
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atggaaatggcatcagcgtttactcttaatgttcgtctggacaacattgctatcatcacc
atcgacgtaccggatgagaaaatgaataccctgaaggcggaatttgcctcgcaggtgcgc
gccattattaagcaactccgtgaaaacaaagagttgcgcggcgtggtgtttatctccgcg
aaaccggacaattttatcgccggagcagacatcaacatgatcggcaactgcaaaacggcg
caagaagcggaagctctggcgcggcagggccaacagttgatggcggagattcatgctttg
cccattccggttatcgcggctattcatggcgcttgcctgggcggtgggctggagctggcg
ctggcgtgccacggtcgcgtttgtactgacgatcctaaaacggtgctcggtttgcctgaa
gtacaacttggattgttacccggttcaggcggcacccagcgtttaccgcgtctcataggc
gtcagcacagcattagagatgatcctcaccggaaaacaacttcgggcgaaacaggcgtta
aagctggggctggtggatgacgtcgttccgcactccattttgctggaagccgctgttgag
ctggtaaagcaggatcgtccatcttcccgccctctacctgtacgcgagcgtattctggcg
gggccgttaggtcgtgcgttgctgttcaaaatggtcggcaagaaaacagaacacaaaact
caaggtaactatccggcgacagaacgcatcctggaggttgtcgaaacgggattagcgcag
ggcaccagcagtggctatgacgctgaagcacgggcgtttggcgaactggcgatgacgccg
caatcgcaggctctgcgtagtatcttttttgccagtacggacgtgaagaaagatcccggc
agtgatgcgccgcctgcgccattaaacagcgtggggattttaggtggtggcttgatgggc
ggcggtattgcttatgtcactgcttgtaaagcggggcttccggtcagaattaaagatatc
aacccgcagggcataaatcatgcgctgaagtacagttgggatcagctggagggcaaagtt
cgccgtcgtcatctcaaagccagcgaacgtgacaaacagctggcattaatctccggaacg
acggactatcgcggctttgcccatcgcgatctgattattgaagcggtgtttgaaaatctc
gaattaaaacaacagatggtggcggaagtggagcaaaattgcgccgctcataccatcttt
gcttcgaatacgtcatctttgccgattggtgatatcgccgctcacgccacgcgacctgag
caagttatcggcctgcatttcttcagtccggtggaaaaaatgccgctggtggagattatt
cctcatgctggtacatcagcgcaaaccatcgccactacggtaaaactggcgaaaaaacag
ggcaaaacgcccattgtcgtgcgtgacaaagccgggttttacgtcaatcgcatcttagcg
ccttacattaatgaagctatccgcatgctgaccgaaggtgaacgggtagagcacattgat
gccgcgctagtgaaatttggttttccggtaggtccaatccaacttttggatgaggtagga
atcgacaccgggactaaaattattcctgtactggaagccgcttatggagaacgttttagc
gcgcctgcaaatgttgtttcttcaattttgaacgacgatcgcaaaggcagaaaaaatggt
cggggtttctatctttatggtcagaaagggcgtaaaagcaaaaaacaggtcgatcctgcc
atttacccgctcattggcgcacaagggcaggggcgactctccgcaccgcaggttgctgaa
cggtgtgtgatgttgatgctgaatgaagcagtacgttgtgttgatgagcaggttatccgt
agcgtgcgtgacggggatattggtgcggtatttggcattggttttccgccatttctcggt
ggaccgttccgctatatcgattctctcggcgcgggcgaagtggttgcaataatgcaacga
ctggccacgcagtatggttcccgttttaccccttgcgagcgtttagtcgagatgagcaag
cgtggggaaagtttttggaaaacaactgcaactgacctgcaataa

DBGET integrated database retrieval system