KEGG   Escherichia coli ATCC 8739: EcolC_1392Help
Entry
EcolC_1392        CDS       T00697                                 

Definition
(GenBank) glycosyl transferase family 39
  KO
K07264  4-amino-4-deoxy-L-arabinose transferase [EC:2.4.2.43]
Organism
ecl  Escherichia coli ATCC 8739
Pathway
ecl00540  Lipopolysaccharide biosynthesis
ecl01503  Cationic antimicrobial peptide (CAMP) resistance
Module
ecl_M00721  Cationic antimicrobial peptide (CAMP) resistance, arnBCADTEF operon
Brite
KEGG Orthology (KO) [BR:ecl00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    EcolC_1392
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    EcolC_1392
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ecl01003]
    EcolC_1392
   01005 Lipopolysaccharide biosynthesis proteins [BR:ecl01005]
    EcolC_1392
Enzymes [BR:ecl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.43  lipid IVA 4-amino-4-deoxy-L-arabinosyltransferase
     EcolC_1392
Glycosyltransferases [BR:ecl01003]
 Polysaccharide
  Bacterial polysaccharide
   EcolC_1392
Lipopolysaccharide biosynthesis proteins [BR:ecl01005]
 Lipid A
  EcolC_1392
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PMT PMT_2
Motif
Other DBs
NCBI-ProteinID: ACA77056
UniProt: B1IXT0
Position
complement(1523960..1525612)
Genome map
AA seq 550 aa AA seqDB search
MKSVRYLIGLFAFIACYYLLPISTRLLWQPDETRYAEISREMLASGDWIVPHLLGLRYFE
KPIAGYWINSIGQWLFGANNFGVRAGVIFATLLTAALVTWFTLRLWRDKRLALLATVIYL
SLFIVYAIGTYAVLDPFIAFWLVAGMCSFWLAMQAQTWKGKSAGFLLLGITCGMGVMTKG
FLALAVPVLSVLPWVATQKRWKDLFIYGWLAVISCVLTVLPWGLAIAQREPNFWHYFFWV
EHIQRFALDDAQHRAPFWYYVPVIIAGSLPWLGLLPGALYTGWKNRKHSATVYLLSWTIM
PLLFFSVAKGKLPTYILSCFASLAMLMAHYALLAAKNNPLALRINGWINIAFGVTGIIAT
FVVSPWGPMNTPVWQTFESYKVFCAWSIFSLWAFFGWYTLTNVEKTWPFAALCPLGLALL
VGFSIPDRVMEGKHPQFFVEMTQESLQPSRYILTDSVGVAAGLAWSLQRDDIIMYRQTGE
LKYGLNYPDAKGRFVSGDEFANWLNQHRQEGIITLVLSVDRDEDINSLAIPPADAIDRQE
RLVLIQYRPK
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcggtacgttaccttatcggcctcttcgcgtttattgcctgctattacctgtta
ccgatcagcacgcgtctgctctggcaacccgatgaaacgcgttatgcggaaatcagtcga
gaaatgctggcatccggcgactggattgtgccccatctgttagggctacgttatttcgaa
aaacccattgccggatactggattaacagcattgggcaatggctatttggcgcgaataac
tttggtgtgcgggcaggcgttatctttgcgaccctgttaactgccgcgctggtgacctgg
tttactctgcgcttatggcgcgataaacgtctggctctactcgccacagtaatttatctc
tcattgtttattgtctatgccatcggcacttatgccgtgctcgatccgtttattgcattc
tggctggtggcgggaatgtgcagcttctggctggcaatgcaggcacagacgtggaaaggc
aaaagcgcaggatttttactgctgggaatcacctgcggcatgggggtgatgaccaaaggt
tttctcgcccttgccgtgccggtattaagcgtgctgccatgggtagcgacgcaaaaacgc
tggaaagatctctttatttacggctggctggcggttatcagttgcgtactgacggttctc
ccttggggactggcgatagcgcagcgggagcctaacttctggcactattttttctgggtt
gagcatattcaacgctttgcactggatgatgcccaacatagagctccgttctggtactac
gtgccggtcatcattgccggtagcctgccgtggctgggattactccccggtgcactgtac
acaggctggaaaaaccgcaagcattccgcaaccgtctatttgttgagctggacgataatg
ccgctgctgtttttctccgtcgctaaaggtaaattgcccacctatattctttcctgcttt
gcatctctggcaatgctgatggcgcattacgctttgctggcagcaaaaaataatcctctg
gcgctgcggattaatggctggattaacatcgcttttggcgtcactggcattattgccaca
tttgtggtctccccgtggggaccaatgaacacgccggtgtggcaaaccttcgagagctat
aaagtcttttgtgcctggtcgattttttcgctatgggcatttttcggctggtacacctta
acaaacgtcgaaaagacctggccttttgccgcgctttgcccgctggggctggcgttgctg
gtaggattttcaattcctgacagagttatggaaggaaaacatccgcaattttttgtcgag
atgacacaagaatcacttcagccaagccgctatattcttactgatagcgtcggtgttgcc
gcaggtctggcatggagcctgcaacgcgatgacatcatcatgtatcgccagacaggtgag
ttgaaatacggccttaattatccggatgcgaaagggagatttgtcagcggtgatgagttc
gcaaactggcttaatcaacatcgtcaggaggggattattactctcgtgctttcggttgac
cgcgatgaagatatcaacagtctcgccattccgcccgcagatgccatcgatcgtcaggag
cgtctggtgctgattcagtatcgtcccaaatga

DBGET integrated database retrieval system