KEGG   Escherichia coli ATCC 8739: EcolC_2328Help
Entry
EcolC_2328        CDS       T00697                                 

Definition
(GenBank) glutamine synthetase catalytic region
  KO
K09470  gamma-glutamylputrescine synthase [EC:6.3.1.11]
Organism
ecl  Escherichia coli ATCC 8739
Pathway
ecl00330  Arginine and proline metabolism
ecl01100  Metabolic pathways
Module
ecl_M00136  GABA biosynthesis, prokaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:ecl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    EcolC_2328
Enzymes [BR:ecl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.11  glutamate---putrescine ligase
     EcolC_2328
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gln-synt_C Gln-synt_N_2
Motif
Other DBs
NCBI-ProteinID: ACA77963
Position
2565723..2567141
Genome map
AA seq 472 aa AA seqDB search
METNIVEVENFVQQSEERRGSAFTQEVKRYLERYPNTQYVDVLLTDLNGCFRGKRIPVSS
LKKLEKGCYFPASVFAMDILGNVVEEAGLGQEMGEPDRTCVPVLGSLTPSAADPEFIGQM
LLTMVDEDGAPFDVEPRNVLNRLWQQLRQRGLFPVVAVELEFYLLDRQRDAEGYLQPPCA
PGTDDRNTQSQVYSVDNLNHFADVLNDIDELAQLQLIPADGAVAEASPGQFEINLYHTDN
VLEACDDALALKRLVRLMAEKHKMHATFMAKPYEEHAGSGMHIHISMQNNRGENVLSDAE
GEDSPLLKKMLAGMIDLMPSSMALLAPNVNSYRRFQPGMYVPTQASWGHNNRTVALRIPC
GDRHNHRVEYRVAGADANPYLVMAAIFAGILHGLDNELPLQEEVEGNGLEQEGLPFPIRQ
SDALGEFIENDHLRRYLGERFCHVYHACKNDELLQFERLITETEIEWMLKNA
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaatatcgttgaagtagagaactttgttcagcagtcagaagagaggcggggt
agcgcctttacgcaggaagtgaaacgctacctggagcgctacccgaatacgcaatatgtt
gatgttttacttaccgatttaaatggttgcttccgtggaaagcgtattcctgtttcaagc
ctgaagaagctcgagaaagggtgttatttcccggcctcggtatttgcaatggatattctg
ggcaacgtagtagaagaagcaggtctgggtcaggaaatgggcgagccggatcgtacctgt
gttcctgttctcggttccttaactccttctgccgccgatccagagtttatcggtcagatg
ctcctgaccatggtcgatgaagatggcgctccctttgacgttgagccgcggaacgttctt
aaccgcctgtggcagcagctgcgccagcgcggattgttcccggtcgtagcggtagagctg
gagttctatttactggatcgccagcgcgacgctgaagggtatctgcaaccgccctgcgcg
cctggcaccgatgaccgcaatacacaaagccaggtttactccgttgataacctcaaccac
ttcgccgacgtgctcaatgatattgatgaactggcgcagttacagctgattccggcagat
ggcgcggtcgctgaggcctcgccgggtcagtttgaaatcaacctttaccatactgataac
gtgctggaagcctgcgatgatgcgctggcactaaaacgcctggtgcgtctgatggcagaa
aagcataagatgcacgccacttttatggcgaagccgtatgaagagcacgcgggcagcgga
atgcatatccatatcagtatgcaaaataatcgtggcgagaacgtgctttctgacgcggaa
ggcgaagattcgccgctgctgaaaaagatgctcgccgggatgattgacctgatgccgtcg
tcgatggcgttgctggcaccaaacgtgaactcgtatcgccgcttccagccgggaatgtat
gtgccgacgcaggcgtcgtggggccataacaaccgcaccgtcgccctgcgtattccgtgc
ggcgaccgtcataatcaccgcgtggaatatcgcgtggcgggtgccgatgccaacccatat
ctggtgatggcagcgatttttgccggtattttgcatggccttgataacgagctgccgttg
caggaagaagtcgaaggcaacgggctggaacaggaaggcttaccctttccgattcgccag
agcgatgccctgggtgagtttatcgagaatgatcacctgcgccgctatttaggcgaacgc
ttctgccatgtctatcacgcctgtaaaaatgatgagctgttgcagtttgagcgcctcatc
acagaaacagaaattgagtggatgttgaaaaacgcgtaa

DBGET integrated database retrieval system