KEGG   Escherichia coli ATCC 8739: EcolC_2566Help
Entry
EcolC_2566        CDS       T00697                                 

Definition
(GenBank) D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
  KO
K12972  glyoxylate/hydroxypyruvate reductase [EC:1.1.1.79 1.1.1.81]
Organism
ecl  Escherichia coli ATCC 8739
Pathway
ecl00260  Glycine, serine and threonine metabolism
ecl00620  Pyruvate metabolism
ecl00630  Glyoxylate and dicarboxylate metabolism
ecl01100  Metabolic pathways
ecl01110  Biosynthesis of secondary metabolites
ecl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ecl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    EcolC_2566
   00630 Glyoxylate and dicarboxylate metabolism
    EcolC_2566
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EcolC_2566
Enzymes [BR:ecl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.79  glyoxylate reductase (NADP+)
     EcolC_2566
    1.1.1.81  hydroxypyruvate reductase
     EcolC_2566
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C NAD_binding_2 DUF551
Motif
Other DBs
NCBI-ProteinID: ACA78197
UniProt: B1IV68
Position
complement(2811088..2812026)
Genome map
AA seq 312 aa AA seqDB search
MDIIFYHPTFDTQWWIEALRKAIPQARVRAWKSGDNDSADYALVWHPPVEMLAGRDLKAV
FALGAGVDSILSKLQAHPEMLKPSVPLFRLEDTGMGEQMQEYAVSQVLHWFRRFDDYRIQ
QNSSHWQPLPEYHREDFTIGILGAGVLGSKVAQSLQTWRFPLRCWSRTRKSWPGVQSFAG
REELSAFLSQCRVLINLLPNTPETVGIINQQLLEKLPDGAYLLNLARGVHVVEDDLLAAL
DSGKVKGAMLDVFNREPLPPESPLWQHPRVTITPHVAAITRPAEAVEYISRTIAQLEKGE
RVCGQVDRARGY
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggatatcatcttttatcacccaacgttcgatacccaatggtggattgaggcactgcgc
aaagctattcctcaggcaagagtcagagcgtggaaaagcggagataatgactctgctgat
tatgctttagtctggcatcctcctgttgaaatgctggcagggcgcgatcttaaagcggtg
ttcgcactcggggccggtgttgattctattttgagcaagctacaggcacaccctgaaatg
ctgaagccttctgttccactttttcgcctggaagataccggtatgggcgagcaaatgcag
gaatatgctgtcagtcaggtgctgcattggtttcgacgttttgacgattatcgcatccag
caaaatagttcgcattggcaaccgctgcctgaatatcatcgggaagattttaccatcggc
attttgggcgcaggcgtactgggcagtaaagttgctcagagtctgcaaacctggcgcttt
ccgctgcgttgctggagtcgaacccgtaaatcgtggcctggcgtgcaaagctttgccgga
cgggaagaactgtctgcatttctgagccaatgtcgggtattgattaatttgttaccgaat
acccctgaaaccgtcggcattattaatcaacaattactcgaaaaattaccggatggcgcg
tatctcctcaacctggcgcgtggtgttcatgttgtggaagatgacctgctcgcggcgctg
gatagcgggaaagttaaaggcgcaatgctggatgtttttaatcgtgaacccttaccgcct
gaaagtccgctctggcaacatccacgcgtgacgataacaccacatgtcgccgcgattacc
cgtcccgctgaagctgtggagtacatttctcgcactattgcccagctcgaaaaaggggag
agggtctgcgggcaagtcgaccgcgcacgcggctactaa

DBGET integrated database retrieval system