KEGG   Escherichia coli ATCC 8739: EcolC_3068Help
Entry
EcolC_3068        CDS       T00697                                 

Definition
(GenBank) 6,7-dihydropteridine reductase
  KO
K10679  nitroreductase / dihydropteridine reductase [EC:1.-.-.- 1.5.1.34]
Organism
ecl  Escherichia coli ATCC 8739
Pathway
ecl00633  Nitrotoluene degradation
ecl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ecl00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    EcolC_3068
Enzymes [BR:ecl01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     EcolC_3068
  1.-  
   1.-.-  
    1.-.-.-  
     EcolC_3068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitroreductase TM1586_NiRdase
Motif
Other DBs
NCBI-ProteinID: ACA78692
Structure
PDB: 

Position
3351812..3352465
Genome map
AA seq 217 aa AA seqDB search
MDIISVALKRHSTKAFDASKKLTPEQAEQIKTLLQYSPSSTNSQPWHFIVASTEEGKARV
AKSAAGNYVFNERKILDASHVVVFCAKTAMDDAWLKLVVDQEDADGRFATPEAKAANDKG
RKFFADIHRKDLHDDAEWMAKQVYLNVGNFLLGVAALGLDAVPIEGFDAAILDAEFGLKE
KGYTSLVVVPVGHHSVEDFNATLPKSRLPQNITLTEV
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggatatcatttctgtcgccttaaagcgtcattccactaaggcatttgatgccagtaaa
aaacttaccccggaacaggccgagcagatcaaaactctcctgcaatacagcccatccagc
accaactcccagccgtggcattttattgttgccagcacggaagaaggtaaagcgcgtgtt
gccaaatccgctgccggtaattatgtgttcaacgaacgtaaaatacttgatgcctcgcac
gtcgtggtgttctgtgcaaaaaccgcgatggacgatgcctggctgaagctggttgttgac
caggaagatgctgatggccgctttgccacgccggaagcgaaagccgcgaacgataaaggt
cgcaagttcttcgctgatatacaccgtaaagatctgcatgatgatgcagagtggatggca
aaacaggtttatctcaacgtcggtaacttcctgctcggcgtggcggcgctgggtctggac
gcggtacccatcgaaggttttgacgccgccatcctcgatgcagaatttggtctgaaagag
aaaggctacaccagtctggtggttgttccggtaggtcatcacagcgttgaagattttaac
gctacgctgccgaaatcacgtctgccgcaaaacatcaccttaaccgaagtgtaa

DBGET integrated database retrieval system