KEGG   Escherichia coli ATCC 8739: EcolC_3311Help
Entry
EcolC_3311        CDS       T00697                                 

Definition
(GenBank) betaine aldehyde dehydrogenase
  KO
K00130  betaine-aldehyde dehydrogenase [EC:1.2.1.8]
Organism
ecl  Escherichia coli ATCC 8739
Pathway
ecl00260  Glycine, serine and threonine metabolism
ecl01100  Metabolic pathways
Module
ecl_M00555  Betaine biosynthesis, choline => betaine
Brite
KEGG Orthology (KO) [BR:ecl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EcolC_3311
Enzymes [BR:ecl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.8  betaine-aldehyde dehydrogenase
     EcolC_3311
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ACA78933
UniProt: B1J0W5
Position
3628308..3629780
Genome map
AA seq 490 aa AA seqDB search
MSRMAEQQLYIHGGYTSATSGRTFETINPANGNVLATVQAAGREDVDRAVKSAQQGQKIW
ASMTAMERSRILRRAVDILRERNDELAKLETLDTGKAYSETSTVDIVTGADVLEYYAGLI
PALEGSQIPLRETSFVYTRREPLGVVAGIGAWNYPIQIALWKSAPALAAGNAMIFKPSEV
TPLTALKLAEIYSEAGLPNGVFNVLPGVGAETGQYLTEHPGIAKVSFTGGVASGKKVMAN
SAASSLKEVTMELGGKSPLIVFDDADLDLAADIAMMANFFSSGQVCTNGTRVFVPAKCKA
AFEQKILARVERIRAGDVFDPQTNFGPLVSFPHRDNVLRYIAKGKEEGARVLCGGDVLKG
DGFDNGAWVAPTVFTDCSDDMTIVREEIFGPVMSILTYESEDEVIRRANDTDYGLAAGIV
TADLNRAHRVIHQLEAGICWINTWGESPAEMPVGGYKHSGIGRENGMMTLQSYTQVKSIQ
VEMAKFQSIF
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgaatggcagaacagcagctttatatacatggtggttatacctccgccaccagc
ggtcgcaccttcgagaccattaacccggccaacggtaacgtgctggcgaccgtgcaggcc
gccgggcgcgaggatgtcgatcgcgccgtgaaaagcgcccagcaggggcaaaaaatctgg
gcgtcgatgaccgccatggagcgctcgcgtattctgcgtcgggccgttgatattctgcgt
gaacgcaatgacgaactcgcaaaactggaaaccctcgacaccggaaaagcatattcggaa
acctcaaccgtcgatatcgttaccggtgcggacgtgctggagtactacgccgggctgatc
ccggcgttggaaggcagccagatcccgttgcgtgaaacgtcctttgtgtatacccgccgc
gaaccgctgggcgtagtggcagggattggcgcatggaactacccgatccagattgccctg
tggaaatccgccccggcgctggcggcaggcaacgcaatgattttcaaaccgagcgaagtt
accccgcttaccgcgttaaagctggctgaaatttacagcgaagcgggcctgccgaacggc
gtatttaacgtgttgccgggcgtgggcgcggagaccgggcaatatctgaccgagcatccg
ggcattgccaaagtgtcatttaccggcggtgtcgccagcggcaaaaaagtgatggctaac
tcggcggcctcttccctgaaagaagtgaccatggaactgggcggtaaatcaccgctgatc
gttttcgatgatgcggatctcgatctcgccgccgatatcgccatgatggcaaacttcttc
agctccggtcaggtgtgtaccaatggcacccgcgtcttcgttccggcgaaatgcaaagcc
gcatttgagcagaaaattctggcgcgcgttgagcgcattcgcgcgggcgacgttttcgat
ccgcaaactaacttcggcccgctggtcagcttcccgcatcgcgataacgtgctgcgctat
atcgccaaaggcaaagaggaaggcgcgcgcgtactgtgcggcggcgatgtactgaaaggc
gatggcttcgataacggcgcatgggttgcaccgacagtgttcaccgattgcagcgacgat
atgaccatcgtgcgtgaagagatcttcgggccagtgatgtccattctgacctacgagtcg
gaagacgaagtcattcgccgcgctaacgataccgactacggcctggcagcgggcatcgtg
acagcggacctgaaccgcgcgcatcgcgtcattcatcagctggaagcgggtatttgctgg
atcaacacctggggcgaatccccggcagagatgcccgttggcggctacaaacactccggc
attggtcgcgagaacggcatgatgacgctccagagttacacccaggtgaagtccatccag
gttgagatggctaaattccagtccatattctaa

DBGET integrated database retrieval system