KEGG   Escherichia coli ATCC 8739: EcolC_3478Help
Entry
EcolC_3478        CDS       T00697                                 

Definition
(GenBank) lipid-A-disaccharide synthase
  KO
K00748  lipid-A-disaccharide synthase [EC:2.4.1.182]
Organism
ecl  Escherichia coli ATCC 8739
Pathway
ecl00540  Lipopolysaccharide biosynthesis
ecl01100  Metabolic pathways
Module
ecl_M00060  KDO2-lipid A biosynthesis, Raetz pathway, LpxL-LpxM type
Brite
KEGG Orthology (KO) [BR:ecl00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    EcolC_3478
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ecl01003]
    EcolC_3478
   01005 Lipopolysaccharide biosynthesis proteins [BR:ecl01005]
    EcolC_3478
Enzymes [BR:ecl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.182  lipid-A-disaccharide synthase
     EcolC_3478
Glycosyltransferases [BR:ecl01003]
 Polysaccharide
  Bacterial polysaccharide
   EcolC_3478
Lipopolysaccharide biosynthesis proteins [BR:ecl01005]
 Lipid A
  EcolC_3478
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LpxB
Motif
Other DBs
NCBI-ProteinID: ACA79092
UniProt: B1IQF9
Structure
PDB: 

Position
complement(3795297..3796445)
Genome map
AA seq 382 aa AA seqDB search
MTEQRPLTIALVAGETSGDILGAGLIRALKERVPNARFVGVAGPRMQAEGCEAWYEMEEL
AVMGIVEVLGRLRRLLHIRADLTKRFGELKPDVFVGIDAPDFNITLEGNLKKQGIKTIHY
VSPSVWAWRQKRVFKIGRATDLVLAFLPFEKAFYDKYNVPCRFIGHTMADAMPLDPDKNG
ARDVLGIPYDAHCLALLPGSRGAEVEMLSADFLKTAQLLRQTYPDLEIVVPLVNAKRREQ
FERIKAEVAPDLSVHLLDGMGREAMVASDAALLASGTAALECMLAKCPMVVGYRMKPFTF
WLAKRLVKTDYVSLPNLLAGRELVKELLQEECEPQKLAAALLPLLANGKTSHAMHDTFRE
LHQQIRCNADEQAAQAVLELAQ
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacagcgtccattaacgattgccctggtcgccggagaaacctccggcgatatc
ctgggggccggtttaatccgcgctctgaaagaacgtgtgcccaacgcccgctttgttggc
gttgccgggccacgaatgcaggctgaaggctgcgaagcctggtacgaaatggaagaactg
gcggtgatgggcattgttgaagtgctcggtcgtctgcgtcgcttactgcatattcgtgcc
gatctgacaaagcgttttggcgaactgaagccagatgtttttgttggtattgatgcgccc
gacttcaatattactcttgaaggtaacctcaaaaagcagggtatcaaaaccattcattac
gtcagtccatccgtctgggcgtggcgacagaaacgcgttttcaaaataggcagagccacc
gatctggtgctcgcatttctgcctttcgaaaaagcgttttatgacaaatacaatgtaccg
tgccgctttatcggtcataccatggctgatgccatgccgttagatccagataaaaatggt
gcccgtgatgtgctggggatcccttacgatgcccactgtctggcattgttgccgggcagc
cgtggtgcagaagtcgaaatgcttagtgccgatttcctgaaaactgcccagcttttgcgc
cagacatatccggatctcgaaatcgtggtgccgctggtgaatgccaaacgccgcgagcag
tttgaacgcatcaaagctgaagtcgcgccagatctgtcggttcatttgctggatggaatg
ggccgtgaggcgatggtcgccagcgatgcggcactactggcgtcggggacggcagccctg
gagtgtatgctggcgaaatgcccgatggtggtgggatatcgcatgaagccttttaccttc
tggttggcgaagcggctggtgaaaactgattatgtctcgctgccaaatctgctggcgggc
agagagttagtcaaagagttattgcaggaagagtgtgagccgcaaaaactggctgcggcg
ctgttaccgctgttggcgaacgggaaaaccagccacgcgatgcacgataccttccgtgaa
ctgcatcagcagatccgctgcaatgccgatgagcaggcggcacaagccgttctggagtta
gcacaatga

DBGET integrated database retrieval system