KEGG   Escherichia coli ATCC 8739: EcolC_3642Help
Entry
EcolC_3642        CDS       T00697                                 

Definition
(GenBank) chaperone protein DnaK
  KO
K04043  molecular chaperone DnaK
Organism
ecl  Escherichia coli ATCC 8739
Pathway
ecl03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:ecl00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    EcolC_3642
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ecl03019]
    EcolC_3642
   03110 Chaperones and folding catalysts [BR:ecl03110]
    EcolC_3642
   03029 Mitochondrial biogenesis [BR:ecl03029]
    EcolC_3642
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecl04147]
    EcolC_3642
Messenger RNA biogenesis [BR:ecl03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Chaperones
     EcolC_3642
Chaperones and folding catalysts [BR:ecl03110]
 Heat shock proteins
  HSP70 / DNAK
   EcolC_3642
Mitochondrial biogenesis [BR:ecl03029]
 Mitochondrial protein import machinery
  Inner mambrane
   MINOS/MitOS complex
    EcolC_3642
  Matrix
   MMC/PAM proteins
    EcolC_3642
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    EcolC_3642
Exosome [BR:ecl04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   EcolC_3642
  Exosomal proteins of breast cancer cells
   EcolC_3642
  Exosomal proteins of colorectal cancer cells
   EcolC_3642
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C
Motif
Other DBs
NCBI-ProteinID: ACA79253
UniProt: B1IRG0
Structure
PDB: 

Position
complement(3988222..3990138)
Genome map
AA seq 638 aa AA seqDB search
MGKIIGIDLGTTNSCVAIMDGTTPRVLENAEGDRTTPSIIAYTQDGETLVGQPAKRQAVT
NPQNTLFAIKRLIGRRFQDEEVQRDVSIMPFKIIAADNGDAWVEVKGQKMAPPQISAEVL
KKMKKTAEDYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYG
LDKGTGNRTIAVYDLGGGTFDISIIEIDEVDGEKTFEVLATNGDTHLGGEDFDSRLINYL
VEEFKKDQGIDLRNDPLAMQRLKEAAEKAKIELSSAQQTDVNLPYITADATGPKHMNIKV
TRAKLESLVEDLVNRSIEPLKVALQDAGLSVSDIDDVILVGGQTRMPMVQKKVAEFFGKE
PRKDVNPDEAVAIGAAVQGGVLTGDVKDVLLLDVTPLSLGIETMGGVMTTLIAKNTTIPT
KHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDA
DGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGD
HLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLME
IAQQQHAQQQTAGADASANNAKDDDVVDAEFEEVKDKK
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaaataattggtatcgacctgggtactaccaactcttgtgtagcgattatggat
ggcaccactcctcgcgtgctggagaacgccgaaggcgatcgcaccacgccttctatcatt
gcctatacccaggatggtgaaactctggttggtcagccggctaaacgtcaggcagtgaca
aacccgcaaaacaccctgtttgcgattaaacgcctgattggccgccgcttccaggacgaa
gaagtacagcgtgatgtttccatcatgccgttcaaaattattgctgctgataacggcgac
gcatgggtcgaagttaaaggccagaaaatggcaccgccgcagatttctgctgaagtgctg
aaaaaaatgaagaaaaccgctgaagattacttgggtgaaccggtaactgaagctgttatc
accgtaccggcatactttaacgatgctcagcgtcaggcaaccaaagacgcaggccgtatc
gctggtctggaagtaaaacgtatcatcaacgaaccgaccgcagctgcgctggcttacggt
ctggacaaaggtactggcaaccgtactatcgcggtttatgacctgggtggtggtactttc
gatatttctattatcgaaatcgacgaagttgacggcgaaaaaaccttcgaagttctggct
accaacggtgatacccacctgggtggtgaagacttcgacagccgtctgatcaactacctg
gttgaagaattcaagaaagatcagggcattgacctgcgcaacgatccgctggcaatgcag
cgcctgaaagaagcggcagaaaaagcgaaaatcgaactgtcttccgctcagcagaccgac
gttaacctgccgtacatcactgcagatgcgaccggtccgaaacacatgaacatcaaagtg
actcgtgcgaaactggaaagcctggttgaagatctggtaaaccgttccattgagccgctg
aaagttgcactgcaggacgctggcctgtccgtatctgatatcgacgacgttatcctcgtt
ggtggtcagactcgtatgccaatggttcagaagaaagttgctgagttctttggtaaagag
ccgcgtaaagacgttaacccggacgaagctgtagcaatcggtgctgctgttcagggtggt
gttctgactggtgacgtgaaagacgtactgctgctggacgttaccccgctgtctctgggt
atcgaaaccatgggcggtgtgatgacgacgctgatcgcgaaaaacaccactatcccgacc
aagcacagccaggtgttctctaccgctgaagacaaccagtctgcggtaaccatccatgtg
ctgcagggtgaacgtaaacgtgcggctgataacaaatctctgggtcagttcaacctggat
ggtatcaacccggcaccgcgcggcatgccgcagatcgaagttaccttcgatatcgatgct
gacggtatcctgcacgtttccgcgaaagataaaaacagcggtaaagagcagaagatcacc
atcaaggcgtcttctggtctgaacgaagatgaaatccagaaaatggtacgcgacgcagaa
gctaacgccgaagctgaccgtaagtttgaagagctggtacagactcgcaaccagggcgac
catctgctgcacagcacccgtaagcaggttgaagaagcaggcgacaaactgccggctgac
gacaaaactgctatcgagtctgcactgactgcactggaaactgctctgaaaggtgaagac
aaagccgctatcgaagcgaaaatgcaggagctggcacaggtttcccagaaactgatggaa
atcgcccagcagcaacatgcccagcagcagactgccggtgctgatgcttctgcaaacaac
gcgaaagatgacgatgttgtcgacgctgaatttgaagaagtcaaagacaaaaaataa

DBGET integrated database retrieval system