KEGG   Escherichia coli ATCC 8739: EcolC_3782Help
Entry
EcolC_3782        CDS       T00697                                 

Definition
(GenBank) ABC transporter related
  KO
K10820  galactofuranose transport system ATP-binding protein [EC:7.5.2.9]
Organism
ecl  Escherichia coli ATCC 8739
Pathway
ecl02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ecl00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    EcolC_3782
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecl02000]
    EcolC_3782
Enzymes [BR:ecl01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.9  ABC-type D-galactofuranose transporter
     EcolC_3782
Transporters [BR:ecl02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Galactofuranose transporter
    EcolC_3782
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 AAA_30 AAA_16 ABC_ATPase AAA_23 RsgA_GTPase AAA_22 MMR_HSR1 AAA_15 DUF2813 TsaE DUF815 DLIC FeoB_N
Motif
Other DBs
NCBI-ProteinID: ACA79387
Position
complement(4137907..4139409)
Genome map
AA seq 500 aa AA seqDB search
MTTNQHQEILRTEGLSKFFPGVKALDNVDFSLRRGEIMALLGENGAGKSTLIKALTGVYH
ADRGTIWLEGQAISPKNTAHAQQLGIGTVYQEVNLLPNMSVADNLFIGREPKRFGLLRRK
EMEKRATELMASYGFSLDVREPLNRFSVAMQQIVAICRAIDLSAKVLILDEPTASLDTQE
VELLFDLMRQLRDRGVSLIFVTHFLDQVYQVSDRITVLRNGSFVGCRETCELPQIELVKM
MLGRELDTHALQRAGRTLLSDKPVAAFKNYGKKGTIAPFDLEVRPGEIVGLAGLLGSGRT
ETAEVIFGIKPADSGTALIKGKPQNLRSPHQASVLGIGFCPEDRKTDGIIAAASVRENII
LALQAQRGWLRPISRKEQQEIAERFIRQLGIRTPSTEQPIEFLSGGNQQKVLLSRWLLTR
PQFLILDEPTRGIDVGAHAEIIRLIETLCADGLALLVISSELEELVGYADRVIIMRDRKQ
VAEIPLAELSVPAIMNAIAA
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgacgactaaccaacaccaggagatcctccgcaccgaaggattaagtaaatttttcccc
ggcgtcaaagcgttagacaacgttgatttcagcctgcgccgcggcgaaatcatggcgctg
ctcggtgaaaacggggcaggaaaatcaacgctaatcaaagcattaactggtgtataccac
gccgatcgcggcaccatctggctggaaggccaggctatctcaccgaaaaataccgcccat
gcacaacaactcggtatcggcaccgtctatcaggaagtaaacctgctacccaatatgtcg
gtcgctgataatctatttataggccgcgaacccaaacgcttcggccttctacgccgcaaa
gagatggaaaagcgcgccaccgaactgatggcatcttacggtttctccctcgacgtgcgc
gaaccgctcaaccgcttttcagtcgcgatgcagcaaatcgtcgctatttgccgggctatc
gatctctctgccaaagtgctgatcctcgatgaacccaccgccagtctcgacacccaggaa
gtggagttactgtttgacctgatgcgtcagttgcgcgatcgcggcgtcagcctgattttt
gtcactcactttctcgatcaggtctatcaggtcagcgatcggatcaccgtcttacgcaac
ggcagtttcgtaggctgtcgggaaacgtgcgagctaccgcagatcgaactggtaaaaatg
atgctggggcgcgagctggatacccacgcgctacagcgtgccgggcgaacattgttgagc
gacaaacccgttgccgcgttcaaaaattacggcaaaaaaggaacgatcgcaccgtttgat
ctcgaagtacgccccggcgagatcgtcggtctggctggattgctgggatcaggacgtacc
gaaaccgccgaagtgatcttcggtatcaaacctgctgacagcggcacggcgttgatcaaa
ggcaaaccgcaaaacctgcgatcgccacatcaggcttcggtactgggcattggcttctgc
ccggaagacaggaaaaccgatggcatcatcgctgccgcctcggtgcgggaaaatatcatc
ctcgctctccaggcccagcgcggctggctacgtcccatttcccgcaaagaacagcaagag
attgccgaacgctttatccgccagcttggcattcgcacaccttcaactgaacaaccgatt
gaatttctctctggcggcaatcagcaaaaagtgttgctttcacgttggctactgacccga
ccgcaatttctgatccttgatgagccaactcgcggcattgatgttggtgcccacgccgag
atcatccgcctgattgaaacgctatgcgccgatggtctggcgctgctggtgatctcctcc
gaactggaagaactggtgggctatgccgaccgggtgatcatcatgcgcgatcgcaaacag
gtggcggagatcccgctggcagagctttccgttccggcgatcatgaacgccattgcggcg
taa

DBGET integrated database retrieval system