KEGG   Escherichia coli ATCC 8739: EcolC_4113
Entry
EcolC_4113        CDS       T00697                                 

Definition
(GenBank) rhamnulokinase
  KO
K00848  rhamnulokinase [EC:2.7.1.5]
Organism
ecl  Escherichia coli ATCC 8739
Pathway
ecl00040  Pentose and glucuronate interconversions
ecl00051  Fructose and mannose metabolism
ecl01100  Metabolic pathways
ecl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ecl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    EcolC_4113
   00051 Fructose and mannose metabolism
    EcolC_4113
Enzymes [BR:ecl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.5  rhamnulokinase
     EcolC_4113
SSDB
Motif
Pfam: FGGY_N FGGY_C
Other DBs
NCBI-ProteinID: ACA79711
UniProt: B1IVH4
Structure
PDB: 
2UYT 2CGL 2CGJ 2CGK

Position
4537852..4539321
AA seq 489 aa
MTFRNCVAVDLGASSGRVMLARYERECRSLTLREIHRFNNGLHSQNGYVTWDVDSLESAI
RLGLNKVCEEGIRIDSIGIDTWGVDFVLLDQQGQRVGLPVAYRDSRTNGLMAQAQQQLGK
RDIYQRSGIQFLPFNTLYQLRALTEQQPELIPHIAHALLMPDYFSYRLTGKMNWEYTNAT
TTQLVNINSDDWDESLLAWSGANKAWFGRPTHPGNVIGHWICPQGNEIPVVAVASHDTAS
AVIASPLNGSRAAYLSSGTWSLMGFESQTPFTNDTALAANITNEGGAEGRYRVLKNIMGL
WLLQRVLQEQQINDLPALISATQALPACRFIINPNDDRFINPETMCSEIQAACRETAQPI
PESDAELARCIFDSLALLYADVLHELAQLRGEDFSQLHIVGGGCQNTLLNQLCADACGIR
VIAGPVEASTLGNIGIQLMTLDELNNVDDFRQVVSTTANLTTFTPNPDSEIAHYVAQIHS
TRQTKELCA
NT seq 1470 nt   +upstreamnt  +downstreamnt
atgacctttcgcaattgtgtcgccgtcgatctcggcgcatccagtgggcgcgtgatgctg
gcgcgttacgagcgtgaatgccgcagcctgacgctgcgcgaaatccatcgttttaacaat
gggctgcatagtcagaacggctatgtcacctgggatgtggatagccttgaaagtgccatt
cgccttggattaaacaaggtgtgcgaggaagggattcgtatcgatagcattgggattgat
acctggggcgtggactttgtgctgctcgaccaacagggtcagcgtgtgggcctgcccgtt
gcttatcgcgatagccgcaccaatggcctaatggcgcaggcacaacaacaactcggcaaa
cgcgatatttatcaacgtagcggcatccagtttctgcccttcaatacgctttatcagttg
cgtgcgctgacggagcaacaacctgaacttattccacacattgctcacgctctgctgatg
ccggattacttcagttatcgcctgaccggcaagatgaactgggaatataccaacgccacg
accacgcaactggtcaatatcaatagcgacgactgggacgagtcgctactggcgtggagc
ggggccaacaaagcctggtttggtcgcccgacgcatccgggtaatgtcataggtcactgg
atttgcccgcagggtaatgagattccagtggtcgccgttgccagccatgataccgccagc
gcggttatcgcctcgccgttaaacggctcacgtgctgcttatctctcttctggcacctgg
tcattgatgggcttcgaaagccagacgccatttaccaatgacacggcactggcagccaac
atcaccaatgaaggcggggcggaaggtcgctatcgggtgctgaaaaatattatgggctta
tggctgcttcagcgagtgcttcaggagcagcaaatcaacgatcttccggcgcttatctcc
gcgacacaggcacttccggcttgccgcttcattatcaatcccaatgacgatcgctttatt
aatcctgagacgatgtgcagcgaaattcaggctgcgtgtcgggaaacggcgcaaccgatc
ccggaaagtgatgctgaactggcgcgctgcattttcgacagtctggcgctgctgtatgcc
gatgtgttgcatgagctggcgcagctgcgcggtgaagatttctcgcaactgcatattgtc
ggcggaggctgccagaacacgctgctcaaccagctatgcgccgatgcctgcggtattcgg
gtgatcgccgggcctgttgaagcctcgacgctcggcaatatcggcatccagttaatgacg
ctggatgaactcaataatgtggatgatttccgtcaggtcgtcagcaccaccgcgaatctg
accacctttacccctaatcctgacagtgaaattgcccactatgtggcgcagattcactct
acacgacagacaaaggagctttgcgcatga

DBGET integrated database retrieval system