KEGG   Enterobacter hormaechei subsp. hoffmannii ECNIH3: ECNIH3_08970Help
Entry
ECNIH3_08970      CDS       T03350                                 

Definition
(GenBank) BglX
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
ecla  Enterobacter hormaechei subsp. hoffmannii ECNIH3
Pathway
ecla00460  Cyanoamino acid metabolism
ecla00500  Starch and sucrose metabolism
ecla01100  Metabolic pathways
ecla01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ecla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ECNIH3_08970
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    ECNIH3_08970
Enzymes [BR:ecla01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     ECNIH3_08970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 Glyco_hydro_3_C Fn3-like
Motif
Other DBs
NCBI-ProteinID: AIN22433
Position
1885997..1888372
Genome map
AA seq 791 aa AA seqDB search
MTVIYKDAGRPVHERVADLLARMTPEEKFAQMHAYWLILDEHGSHRERSDLSDEFAGVSE
QASLSERLKLGVGQITRPLGTHIVDAKTGVRAANRLQRMMMEETRLGIPALFHEECLVGL
LCKDATLFPSSLNYGSTWDPALVQRAAEHIGNEARSVGCQQGLAPVLDVSRDVRWGRTEE
TFGEDPWLVGVMATAYVKGLQGDKRDLLATLKHYVGHSFSEGARNHAPVHLGFSELNDTF
LLPFEMAVKLANAGSVMPAYHDIDNQPGHSDHFLLTTVLREQWGFDGIIVADYGGVSLLH
QHHGISHDPAESAALAFNAGLDVELPKDDCARHLAEAVERGLISMAKVDEIVARVLSEKF
RLGLFEKPYADEKGIDLQNEATRQVAREVATKSITLLENNGILPLGGKPRVAVVGPTADD
PLALLSGYSFPVHLIISDMVEETSQVTTPRAALEQYLGASQIRYAKGCHIIEKRMAGAPV
FPGDSGGKPMQQSPVSQRTDLIPEAVSAAKESDVVVACVGDLAGLFQSGTVGEGSDTDSL
NLPGVQQQLLEELVATGKPVIVVMTGGRPYNLQGLEEKVAALMMAWAPGQEGGWAIADIL
TGRAEPQGRLVVSVPKNAGAMPYYYNHKLKSGGTPFAFHFGALYPFGYGLGWTQFRWSAA
RLAESHVPVDGEVVLSVDVSNIGERSGSEVIQVYVRDKVATQVRPLQELKAFQRVTLSPG
ENATLTFTLPVEMFNFTRRDGKRIVEPGEFELQVGASSADIREVVNVQVTGETRVLEGEW
QMLSRSEICKN
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atgactgtgatctacaaggacgcgggacgtcccgtacacgagcgtgtcgctgatttactg
gcgcgtatgacgccggaagagaaatttgcccagatgcacgcgtactggctgatcctcgat
gaacacggcagccaccgcgagcgcagcgatttgagcgatgagttcgccggcgtgagcgaa
caggcgtccctcagcgaaaggctgaagctgggcgtcgggcagatcacccgtccgctcggc
acgcacattgttgatgcaaaaaccggcgtgcgtgccgctaaccgcctgcaacgtatgatg
atggaggagacccggctcggcattccggcgctgtttcatgaggagtgtctggtggggctg
ctgtgcaaagatgcaaccctgttcccgtcgtcgctgaactacggttccacctgggacccg
gcgctggtgcagcgcgcggcggagcatattggcaacgaggcccggtctgtcgggtgccag
caggggctggccccggtgctggatgtctcgcgcgatgtgcgctggggacggacggaagag
acctttggggaagatccgtggctggtaggggtgatggcgacggcgtacgtgaaggggttg
cagggcgataagcgcgatctgctggcgaccctgaaacattacgtggggcactccttcagc
gaaggggcgcgcaaccatgcgccggtccatctgggtttcagcgagctaaacgataccttc
ctgctgccgtttgagatggcggtgaagctggccaacgccggttcggtgatgccagcctat
catgacatcgataatcagccagggcacagcgaccatttcctgctcaccaccgtgctgcgt
gaacagtggggcttcgacggcattattgtcgcggattacggcggcgtcagcctgctgcac
cagcaccatgggatttctcacgatccagcagaatcggcggcgctggcgtttaacgccggg
ctggacgtggaattgccgaaggatgactgcgcgcgtcatctggcggaagcggtagagcgt
gggcttatctcaatggcgaaagtggatgagattgtggcgcgcgtgctaagtgaaaaattc
cgtctcgggctgtttgaaaaaccgtacgccgacgaaaaaggtatcgatttgcagaatgag
gcgacccggcaggtggcgcgcgaggtggcaacaaaatcgatcacgctgctggaaaataac
ggcattttgcccctcggcggaaaaccccgtgtagcggtagtggggccgacggcggacgat
ccgctggcgttgctgagcggctacagcttcccggttcacctgatcatcagcgatatggtt
gaagagacctcgcaggtgacaaccccgcgcgcggcgctggaacagtaccttggtgcatcg
cagatacgttacgccaaagggtgccacattatcgaaaaacggatggcgggtgcgccggtg
ttcccgggcgacagcggcggtaaaccgatgcagcaatcgccggtttcacaacgcacggat
ttgatccccgaagccgtgagcgcggcaaaagagagtgacgtggtggtggcctgcgtgggc
gacctcgccgggctattccagagcggcaccgtgggggaaggatcggataccgattcgctg
aatctgccgggcgtgcagcaacagctgcttgaggagctggtggcaaccggcaagccggta
attgtcgtcatgacgggcgggcgtccttataaccttcaggggctggaagagaaggtggcc
gcgctgatgatggcctgggcgccggggcaggaagggggctgggcgattgccgatatctta
accggccgcgcggagccgcagggcaggctggtagtcagcgtgccgaaaaacgccggggcg
atgccgtactactataaccacaagctgaaaagcggcggcacgccgtttgcgttccatttc
ggcgcactttacccgttcggttacggtcttggctggacgcagtttcgctggagtgcggcg
cgtctcgctgaaagccacgtcccggtcgacggagaggtggtgttaagcgtcgatgtcagc
aacatcggggagcgcagcggcagcgaagtaatacaggtgtacgtgcgtgacaaagtcgcg
acgcaggttcgtccgcttcaggagctgaaagcgtttcaacgcgttacgctttcaccggga
gaaaacgccaccctgacctttaccttgccggtggagatgtttaatttcacccgccgggac
gggaagcggattgtcgagccaggggaatttgagctacaggttggcgcgtcctcggcggat
atacgcgaggtggtgaacgtgcaggtgaccggggagacgcgggtgctggagggggaatgg
cagatgttgagtaggagtgaaatttgtaaaaattaa

DBGET integrated database retrieval system