KEGG   Enterobacter cloacae ECNIH3: ECNIH3_10860Help
Entry
ECNIH3_10860      CDS       T03350                                 

Definition
(GenBank) glycosyl hydrolase family 32
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
ecla  Enterobacter cloacae ECNIH3
Pathway
ecla00052  Galactose metabolism
ecla00500  Starch and sucrose metabolism
ecla01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    ECNIH3_10860
   00500 Starch and sucrose metabolism
    ECNIH3_10860
Enzymes [BR:ecla01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     ECNIH3_10860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: AIN22796
Position
complement(2303628..2305034)
Genome map
AA seq 468 aa AA seqDB search
MTLPSRWPAVLQAVMQGQPRALADSHYPQWHPAPVTGLMNDPNGFIWFAERYHLFYQWNP
LGCDHRYKCWGHWSSADLVHWQHEPMALMPDEEYDRNGCYSGSAVDNNGVLTLCYTGNVK
FDDGGRTAWQCLAVQNDDGTFAKLGPVLPLPDGYTGHVRDPKVWRHDGQWYMVLGAQDQH
KRGKVLLFTSADLHTWASCGEIAGHGVNGLTDAGYMWECPDLFALDGTHVLICCPQGLAR
EPHRYLNTYPAVWMSGAFDYQTPAFAHDELHELDAGFEFYAPQTTVAEDGRRILIGWMGV
PDGEEMLQPTRGHGWIHQMTCPRELRYRDGKLWQTPVRELETLREDEHHWQGRASDAPVL
EGTRLEFELSASCVKVDFAGALRLIVDDAGIRLERASLETGETLTRYWQGSVHHLRVLCD
RSSVEIFINHGEGVMSSRYFPDHPAQVRFEGASDITLRYWSLRSCMIE
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgaccttaccttcccgctggcctgccgtgttgcaggccgttatgcaaggccagccgcgt
gcgctggcggacagccactatccgcagtggcatcccgcaccggtgacagggctgatgaac
gatccgaacggctttatctggtttgccgaacgttaccatctgttttatcagtggaacccg
ctgggctgcgatcatcgctacaagtgctggggacactggagctcagcagatctggtgcac
tggcagcacgagccaatggcgctgatgcctgacgaagagtatgaccgcaatggctgttac
tccggcagcgccgtggataacaacggcgtgctgaccctgtgctataccggcaacgttaag
tttgacgatggcggccgcaccgcctggcagtgtctggcggtgcaaaatgacgacggcacg
tttgccaaactgggaccggtgttgcccctgccggacgggtataccgggcacgtccgcgac
ccgaaagtgtggcgccatgacgggcagtggtacatggtgctcggggcgcaggatcagcat
aagcgcggcaaggtgctgctgtttacgtcagccgatttgcacacctgggcgtcctgcggc
gaaatcgctggtcacggcgtcaacggactcacggacgcgggctatatgtgggagtgcccg
gatctgtttgcgcttgatggcacacacgtcttgatctgctgcccacaggggctggcgcgc
gaaccgcatcgctatctcaacacctatccggccgtctggatgagtggggcatttgattat
caaacgcctgcatttgcgcacgacgaattgcatgagcttgatgccggtttcgaattttac
gcgccgcaaaccacggtggcagaagatggccgccgcatcctcatcggctggatgggcgtg
ccggacggcgaagagatgctccagcctacacgggggcacggctggatccaccagatgacc
tgtccgcgcgagctgcgctaccgcgacggtaagctctggcaaacgccggtccgtgagctg
gaaacgctgcgcgaggatgaacatcactggcagggacgcgccagcgatgccccggtgctg
gagggaacccgtcttgagttcgaactgagcgcatcgtgcgtaaaagtggattttgccggc
gcgttgcggctgattgtggatgatgcggggatccgtctggaacgcgccagcctggaaacc
ggagagacgttgacccgctactggcagggctctgttcatcatttacgcgtgctgtgtgac
cgttccagcgtcgaaattttcatcaatcacggtgaaggcgtcatgagcagccgctatttt
cctgaccatccggcccaggttcgcttcgaaggtgcgtccgacatcacattacgctactgg
tcgctgcgcagctgcatgatagaatag

DBGET integrated database retrieval system