KEGG   Enterobacter hormaechei subsp. hoffmannii ECNIH3: ECNIH3_14840Help
Entry
ECNIH3_14840      CDS       T03350                                 

Definition
(GenBank) hypothetical protein
  KO
K07676  two-component system, NarL family, sensor histidine kinase RcsD [EC:2.7.13.3]
Organism
ecla  Enterobacter hormaechei subsp. hoffmannii ECNIH3
Pathway
ecla02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ecla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ECNIH3_14840
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ecla01001]
    ECNIH3_14840
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:ecla02022]
    ECNIH3_14840
Enzymes [BR:ecla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     ECNIH3_14840
Protein kinases [BR:ecla01001]
 Histidine kinases
  NarL family
   ECNIH3_14840
Two-component system [BR:ecla02022]
 NarL family
  RcsC-RcsD-RcsB (capsule synthesis)
   ECNIH3_14840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RcsD_ABL HATPase_c Hpt NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AIN23537
Position
3144158..3146830
Genome map
AA seq 890 aa AA seqDB search
MSQTETTAPSKFSLLPGSITRFFLLLIVVLLVTMGVMVQSAVNTWLKDKSYQIVDITHAV
HKRIDTWRYATWQIYDNIAAAPATSSGEGLQETRLKQDVYYLEKPQRKTEALIFGSHDSA
TLEMTQRISSYLDTLWGAETVPWSMYYLNGQDNSMILISTLPLKDLSSGFKETTVGSIVD
SRRAEMLQQANALDERESFSSLRRLAWQNGHYFTLRTTFNQPGHLATVVAFDLPINDLIP
PDMPLDSFRLEPDNSTQNMRTPSDKEGPDSVAISFNGSKIEIASSLNSTGMRLVWQVPFG
TLMLDTLQNIMLPLLLNIGLLALALFGYSTFRFQSGRQSDSTSVSAGTSNELRVLRALNE
EIISVLPLGVLVHDQEANRTVMSNKIADHLLPHLNLQNITAMADQHQGVIQATINNELYE
IRQFRSQVASRTQIFIIRDQDREVLVNKKLKQAQRLYEKNQHGRAAFMQNIGDAFKQPLK
SLATQIADLSTPESRQLSSQADSLVRLVDEIQLANMLENDIWKGTPTLFSIQDLIDEVVP
EVLPVIKRKGLQLLINNHLPANDERHGDRDALRRILMMLIQYAVTTTQIGKITLEVSTDE
STDDRLTFRILDTGEGVTVSEIDNLHFPFLNDTQRDHYGKANALTFWLCDQLARKLGGHL
NIKARESLGTRYSLHVKMAANPQEEDEERLLDDVVVMVDVTSSEIRNIVVRQLENWGASC
ITPDERLASQEFDLFLTDNPSNLTASGLLLSDDEPGVRKIGPGQLRVNFNMSNAMQEAVL
QLIEENLAQEEILESPLGGDENAELHASGYYSLFVDTVPDDVKRLYTESAAQDFAALAQT
AHRLKGVFAMLNLVPGKQLCETLEHLIREKDASGIEKYISDIDAYVKSLL
NT seq 2673 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagactgaaactaccgccccgagcaaattctcccttctaccgggcagcatcacc
cgtttctttcttctgttgatcgttgtgctgttagtcacaatgggagtgatggttcagagc
gccgtgaatacctggcttaaagataaaagctatcaaattgtcgatatcacccatgcggtg
cataagcgcattgatacgtggcgctacgcgacctggcaaatctacgacaatatcgccgcc
gcacctgccacctcatcaggcgaagggttgcaggaaacgcgccttaagcaggatgtgtat
taccttgaaaaaccgcagcgcaagacggaagccctgattttcggctcgcacgacagcgca
acgcttgagatgacgcagcggatctcctcctatctggacaccctgtggggcgccgagacc
gtaccgtggtccatgtattacctgaacggtcaggacaacagcatgatcctgatctcgacc
ctgccgcttaaggatctctcgtcgggctttaaagagaccaccgttggcagcattgtcgat
tcccgtcgggcagaaatgctgcaacaggccaacgcgctggacgagcgcgaaagtttctcg
tcattacgccgtcttgcctggcagaatggccactactttacgctgcgaaccacctttaac
cagccgggccatctggcgaccgtggttgccttcgatctgccaattaacgatcttatcccg
ccggatatgccgctggacagtttccgactggagccagacaacagcacccaaaatatgcgc
acgccgtcggataaagaaggcccggacagcgtagcgatctcctttaatggctcgaagatt
gagattgcctcatcgctcaactcaaccggtatgcggctggtgtggcaggtgccttttggc
accctgatgcttgataccctgcaaaacattatgctgccgctgctgttgaatatcggcctg
ctggcgctggcgctgtttggctacagcaccttccgtttccagtcgggccgccagagcgac
tcgacgtcggtatcagctgggaccagcaacgagttgcgtgttcttcgtgccctgaatgaa
gagattatttccgtgctgccgcttggggtgcttgttcacgatcaggaggcaaaccggacg
gtgatgagcaacaaaattgccgatcaccttctgccgcatcttaacctgcaaaatattacg
gccatggcggaccagcatcagggcgtcattcaggccaccattaataatgaactgtatgag
atccgtcagttccgcagtcaggtcgcctcgcgcacgcaaatcttcatcatccgcgatcag
gatcgcgaagtgctggtgaataaaaagctcaagcaggcgcaaaggctgtatgagaaaaac
cagcatggccgcgcggcgtttatgcaaaacattggcgatgcctttaaacagccgctgaag
tcactcgccacgcagattgctgatttaagcacgccggaaagccgacagcttagcagccag
gccgactcgctggttcgtctggtggacgaaatccagcttgcgaacatgctggagaatgac
atctggaagggcacccctacgctcttctccattcaggatctgattgatgaggtggttccg
gaagtcctgccggtgatcaagcgcaaagggctccagctgctgatcaacaaccatttaccg
gccaatgacgagcgtcacggcgatcgcgatgccctgcgtcgcatcctgatgatgttgatt
cagtatgccgtcaccacgacacagatcggcaagatcacccttgaagtcagcaccgatgag
tccaccgacgatcgtctgacgttccgtattctggatacgggcgaaggcgtcaccgtgagc
gaaatcgataacctgcacttcccgttcctgaacgatacccagcgcgaccactacggtaag
gcgaatgccctcaccttctggctctgcgatcagctggcgcgtaagctgggcggtcatctg
aacattaaggcgcgcgaatccctcggcacccgctactccttgcatgttaaaatggcggcg
aatcctcaggaagaggatgaagagcgtctgctggatgatgtggtggtgatggtggacgtg
acctccagtgagatccgtaatatcgtcgttcgtcagctggaaaactggggcgcgtcctgc
attaccccggacgaaaggctcgcgagtcaagaatttgatctatttttaactgataatccg
tctaatcttactgcctccggcttgcttttaagcgatgatgagccaggcgtgcggaaaatc
ggccctgggcagctgcgcgtcaactttaatatgagcaatgcaatgcaggaagctgtatta
caactgattgaagagaatctggcgcaggaagagatcctggagtcaccgttaggcggcgat
gaaaatgccgaactccatgccagcggatattattcgctcttcgttgatacagtaccagat
gatgttaagcggttgtatactgagtccgctgcgcaggattttgcagcgctggcacagaca
gcacaccggcttaaaggggtgtttgccatgcttaatctggttcccggcaagcagttatgt
gaaacgctggaacatctaattcgtgagaaagatgcctctggcattgaaaaatacatcagc
gacattgacgcttacgtcaagagcttgctgtag

DBGET integrated database retrieval system