KEGG   Enterobacter hormaechei subsp. hoffmannii ECNIH3: ECNIH3_14850Help
Entry
ECNIH3_14850      CDS       T03350                                 

Definition
(GenBank) histidine kinase
  KO
K07677  two-component system, NarL family, capsular synthesis sensor histidine kinase RcsC [EC:2.7.13.3]
Organism
ecla  Enterobacter hormaechei subsp. hoffmannii ECNIH3
Pathway
ecla02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ecla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ECNIH3_14850
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ecla01001]
    ECNIH3_14850
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:ecla02022]
    ECNIH3_14850
Enzymes [BR:ecla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     ECNIH3_14850
Protein kinases [BR:ecla01001]
 Histidine kinases
  NarL family
   ECNIH3_14850
Two-component system [BR:ecla02022]
 NarL family
  RcsC-RcsD-RcsB (capsule synthesis)
   ECNIH3_14850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RcsC Response_reg HATPase_c HisKA
Motif
Other DBs
NCBI-ProteinID: AIN23539
Position
complement(3147609..3150455)
Genome map
AA seq 948 aa AA seqDB search
MKYLVSFRTTLKVSRYLFRALALLLWLLVALLSVFYIVNALHQKEAEIRQEFNLSSDQAQ
RYIQRTSDVMKELKYIAENRLTAENGILALRGRDEKTEVPDFEPLFPDSDCSAMGKAWRG
SLESLSWFMRYWRDNFSAAYDLNRVYLIGNENLCMADFGLRDMPVEREDALKSLHERIVK
YRNAPQEERGNNIFWISQGPRMGVGYFYALTPVYLGNRLQALLGIEQTIRMENFFTPGSL
PMGVTILDENGHPLISLTGPENRLKVEPSWMQERSWFGYTSGFRELVLKKSLPPSSLSIV
YSLPVDKVLERIRILILNAILLNIAVGVALFMLARMYERRIFIPAEADAQRLEEHEQFNR
KIVASAPVGICILRTQDGTNILSNELAHNYLNMLTHEDRQRLTQIICGQQVNFVDVLTST
HTNLQISFVHSRYRNENVAICVLVDVSARVKMEESLQDMAQAAEQASQSKSMFLATVSHE
LRTPLYGIIGNLDLLQTKELPKGVDRLVTAMNNSSSLLLKIISDILDFSKIESEQLKIEP
REFSPREVMNHISANYLPLVVRKQLGLYCFIEPDVPLTLHGDPMRLQQVISNLLSNAIKF
TDIGCIVLHVCRAGEYLTIRVRDTGVGIPAKEVVRLFDPFFQVGTGVQRNFQGTGLGLAI
CEKLISMMDGDISVDTEPGMGSQFTIRIPLYSAHYPVKTTVDGLSDKHCWLAVHNASLHD
FLTSMLTSSGVRVSRYEGQTPDADDMLITDVEPDKAWAGRGVVMFCRRHIGIPIERSPGV
WVHSVATPHEMLGLLARIYSVQLEDSDGATVLASPDELASVNDDMMILVVDDHPINRRLL
ADQLGSLGYQCKTANDGVDALNVLSKNHIDIVLSDVNMPNMDGYRLTQRIRQLGLTLPVV
GVTANALAEEKQRCLESGMDSCLSKPVTLDVLKQTLSVYAERVRKARQ
NT seq 2847 nt NT seq  +upstreamnt  +downstreamnt
ttgaaatacctcgtctcctttcgtaccacgttaaaagtctctcgctatctgtttcgggcg
cttgcgctactgctatggttgctggtggcactgctctcggtgttttacatcgttaacgcg
ttacaccagaaagaagcggagatccgccaggagtttaacttaagctcggatcaggcccag
cgctatatccagcgcacgtctgatgtgatgaaagagcttaagtatatcgctgagaatcga
ctgacggcggagaacggcattcttgccctccgcggtcgggatgaaaaaaccgaagtacct
gatttcgaaccgctcttcccggactccgattgttccgcgatgggcaaagcctggcgtggc
tcactggagtccctgtcatggtttatgcgctactggcgcgataatttttcggccgcttac
gatctaaaccgcgtctacctgattggcaacgaaaatctttgcatggcggacttcggtctg
cgggatatgcccgtcgaacgcgaagacgcgctgaaaagcctgcatgagcgcatagtgaaa
taccgcaatgcgcctcaggaagagcgcgggaacaacatcttctggataagccaggggccg
cgcatgggcgtcggctatttctatgccctgactccggtttacctcggaaaccgcctgcaa
gcgctgctggggattgaacaaaccatccgcatggaaaacttcttcacgccgggcagtctg
ccgatgggcgtgaccattctggatgagaacggccacccactcatctcccttaccgggcct
gaaaaccgcctgaaggtggagcccagctggatgcaggagcggtcatggtttggctatacc
tccgggttccgcgagctggtgctgaagaaaagtttaccgccatcgtcgctgagcattgtc
tattcgctgccggtggacaaggtgctggagcgcattcgcatcctgatccttaacgccatt
ttgttgaacatcgcggtaggcgtcgcgctgtttatgctggcgagaatgtatgagcggcgg
atctttattccggcggaagcggatgctcagcgtctggaggagcacgagcagtttaaccgt
aagattgtcgcctcggcgccggtagggatctgtatcctgcgtactcaggacgggacaaat
atcctcagtaacgagcttgcccataactacctgaacatgctcacgcatgaagaccgccag
cggttaacgcagatcatctgtgggcaacaggttaactttgtggatgtgctgaccagcacc
cacaccaacctgcaaatcagcttcgtccattcgcgctaccgcaatgaaaacgtggcgatt
tgcgtgctggtggacgtctccgcgcgcgttaagatggaagagtcattgcaggatatggcg
caggcggcggagcaggccagccagtcgaaatcgatgttcctcgcgaccgtcagccatgag
ctgcgtacgccgctgtacggcattatcggtaacctcgatcttctccagaccaaagagctg
ccgaaaggggtcgaccgcctggtgacggcgatgaacaactcgtccagcctgctgctgaaa
attatcagcgatattctcgacttctctaaaattgaatccgagcagttgaaaatagaaccg
cgtgagttctccccgcgcgaggtgatgaaccatatcagcgccaactatctgccgctggtg
gtgcgcaaacagctggggctgtactgctttatcgagccggatgtgccgctgacgctgcat
ggcgatccgatgcgtctgcaacaggtcatctcgaacctgctaagcaacgccatcaaattc
accgatatcggctgtattgtgctgcatgtctgccgggcaggggagtacctgactattcgc
gtgcgcgacacgggtgttggcattccggcgaaagaggtcgttcgcctgttcgatccgttc
ttccaggtggggacgggcgtccagcgtaatttccaggggaccgggctgggcctggcgatt
tgcgagaagcttatcagcatgatggacggggatatctccgtcgataccgagccgggtatg
ggcagccagttcaccatccgtatcccgctctactcggcacactatccggtgaaaaccacg
gtcgacgggctgagcgataagcactgctggctggcggtgcacaacgcctccttacatgat
ttcctgacctcgatgctgaccagcagcggtgtgcgggtctcacgctatgaaggccagacg
ccggacgcagatgacatgctgattactgacgttgagccagacaaggcgtgggcggggcgg
ggcgtggtgatgttctgccgccgtcatatcggtattccgattgagcgttcgcccggggta
tgggtgcacagtgtggcgacaccgcacgaaatgttgggcttgctggcgcgtatttacagc
gtacagcttgaggacagcgatggcgctaccgtgctggcttcccctgatgagctggcatcg
gtgaatgacgatatgatgattctggtcgtcgacgatcatccgattaaccgtcgtctgctc
gcagaccagcttggctctctgggctatcagtgtaaaacggccaatgatggtgtggatgcc
ctgaatgtcttaagtaagaatcatattgatattgtgctcagcgatgtgaacatgcctaac
atggacggctatcgtctgacgcagcgtatccgacagctggggctgacgctgccggtggtg
ggggtgacagccaacgcactggcggaggagaagcagcgctgtctggagtcgggaatggac
agctgcctgtcgaagccggtcacgctggatgtactgaagcagacgctatccgtgtatgcg
gagcgggtgcgaaaagcaagacaataa

DBGET integrated database retrieval system