KEGG   Enterobacter hormaechei subsp. hoffmannii ECNIH3: ECNIH3_17000Help
Entry
ECNIH3_17000      CDS       T03350                                 

Gene name
surE
Definition
(GenBank) stationary phase survival protein SurE
  KO
K03787  5'-nucleotidase [EC:3.1.3.5]
Organism
ecla  Enterobacter hormaechei subsp. hoffmannii ECNIH3
Pathway
ecla00230  Purine metabolism
ecla00240  Pyrimidine metabolism
ecla00760  Nicotinate and nicotinamide metabolism
ecla01100  Metabolic pathways
ecla01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ecla00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ECNIH3_17000 (surE)
   00240 Pyrimidine metabolism
    ECNIH3_17000 (surE)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    ECNIH3_17000 (surE)
Enzymes [BR:ecla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     ECNIH3_17000 (surE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SurE
Motif
Other DBs
NCBI-ProteinID: AIN23939
Position
complement(3595870..3596631)
Genome map
AA seq 253 aa AA seqDB search
MRILLSNDDGIHAPGIQTLAKHLREFADVQVVAPDRNRSGASNSLTLESSLRTFTFENGD
IAVQMGTPTDCVFLGVNALMRPRPDVVVSGINAGPNLGDDVIYSGTVAAAMEGRHLGFPA
LAVSLNGHTHYDTAAAVTCSILRALGREPLRTGRILNINVPDLPLDEIKGIRVTRCGSRH
PADQVIPQQDPRGNTLYWIGPPGDKCDAGPDTDFAAVDEGYVSVTPLHVDLTAYSAHDVV
SDWLDRVGVNAQW
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatattgctgagtaacgatgacgggatccatgcgccaggtattcagacgctggcg
aaacacctccgcgaatttgcggatgtgcaggtcgtggctcccgatcgtaaccgcagtggc
gcgtctaactcattgacgctggagtcttcacttcgcacctttacctttgagaatggcgat
attgccgtccagatggggacgccgaccgactgcgtgtttctgggcgtgaacgcgctgatg
cgcccgcggccggatgttgtggtctccggcatcaatgccgggccaaatcttggcgatgat
gtgatttactccggcaccgtggctgcggcgatggaagggcgtcacctggggtttccggcg
ctggcggtctcgttaaacggtcacacccactatgacacagccgctgcggtgacctgctcc
attctccgtgcgcttggccgcgagccgctgcgtaccggacgtatcctcaatattaacgtg
ccggacctcccgctggacgagatcaaagggatccgcgtgacgcgctgtggcagtcgccat
cctgccgatcaggttattccccagcaggatccgcgcggcaataccctgtactggatcggc
ccgccgggagataaatgcgatgccgggccagacaccgacttcgctgcggtggatgaaggg
tacgtttccgttacgccgttgcacgtagatttaaccgcttatagcgcgcatgatgtggtg
tcggactggttagatcgggtcggagtgaacgcgcaatggtaa

DBGET integrated database retrieval system