KEGG   Enterobacter hormaechei subsp. hoffmannii ECNIH3: ECNIH3_17215Help
Entry
ECNIH3_17215      CDS       T03350                                 

Definition
(GenBank) 23S rRNA methyltransferase
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
ecla  Enterobacter hormaechei subsp. hoffmannii ECNIH3
Brite
KEGG Orthology (KO) [BR:ecla00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ecla03009]
    ECNIH3_17215
Enzymes [BR:ecla01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     ECNIH3_17215
Ribosome biogenesis [BR:ecla03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    ECNIH3_17215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RlmM_FDX FtsJ DUF4222 MIT_C Spt5-NGN
Motif
Other DBs
NCBI-ProteinID: AIN23982
Position
complement(3646235..3647335)
Genome map
AA seq 366 aa AA seqDB search
MNKVVLYCRPGFEKECAAEITDKAAKREVFGFARVKENAGYVVFECYQPDDADKLARELP
FSSLIFARQMFVAGELLKDLPPEDRITPIVGLLQGVVEKGGDLRVEVADTNESKELMKFC
RKFTVPLRAALRDAGVLTNYETPKRPVVHIFFIAPGCCYTGYSYTTNNSPFFMGIPRLRF
PSDAPSRSTLKLEEAFHVFIPADEWDERLANGMYAVDLGACPGGWTYQLVKRNMWVSSVD
NGPMAQSLMDTGQVTWLREDGFRYRPTRNNISWMVCDMVEKPAKVAALMASWLVNGWCRE
TIFNLKLPMKKRYEEVSQNLAYIQQQLDEHGINAEIQARQLYHDREEVTVHIRRWWAAVG
GRRDER
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgaataaggttgttttatattgtcgcccggggtttgagaaagagtgcgccgcggaaatc
accgataaagcggcgaagcgtgaagtcttcggattcgctcgcgtcaaagagaacgcgggc
tatgtggtatttgaatgctatcagcctgatgatgccgacaagctggcgcgcgaactgccg
ttcagctcgctgattttcgcccgtcagatgtttgtcgcgggcgaattactgaaagatctt
ccgccggaagatcgcatcacgccgattgttggcctgttgcagggcgtggtggagaagggc
ggcgatttgcgcgtggaagtggctgacaccaatgaaagcaaagagctgatgaagttctgc
cgtaagtttaccgtgccgctccgcgcggcactgcgtgatgcgggagtgctgacaaactac
gaaacgccaaagcgtccagtcgtgcatatcttctttattgcgccaggatgttgctacacc
ggctactcgtataccaccaataactcgccgttctttatggggatcccgcgtctgcgcttc
ccgtcagacgcgccgagccgttcaaccctgaagctggaagaggcgttccacgtctttatc
ccggcggacgagtgggacgaacgtctggcaaacggcatgtatgccgtcgatcttggcgcg
tgcccgggcggctggacctatcagctggtgaaacgcaacatgtgggtttcgtctgtggat
aacggcccgatggcgcaaagcctgatggacaccgggcaggtcacctggctgcgtgaagat
ggtttccgctaccgtcctacccgtaacaacatctcctggatggtgtgcgacatggtagaa
aaaccggcgaaagtcgcagcgctgatggcctcctggctggtgaacggctggtgtcgtgag
acgattttcaacctcaagctgccgatgaaaaagcgttacgaagaggtgtcgcagaacctg
gcttatattcagcagcaactggacgaacacgggattaacgcggaaatccaggcgcgtcag
ctgtatcacgaccgtgaagaagtgacggtgcatatccgtcgctggtgggcggccgtgggt
gggcgtcgcgacgagcgataa

DBGET integrated database retrieval system