KEGG   Enterobacter hormaechei subsp. hoffmannii ECNIH3: ECNIH3_17380Help
Entry
ECNIH3_17380      CDS       T03350                                 

Definition
(GenBank) 6-phospho-beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ecla  Enterobacter hormaechei subsp. hoffmannii ECNIH3
Pathway
ecla00010  Glycolysis / Gluconeogenesis
ecla00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:ecla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECNIH3_17380
   00500 Starch and sucrose metabolism
    ECNIH3_17380
Enzymes [BR:ecla01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     ECNIH3_17380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-ProteinID: AIN24012
Position
complement(3684166..3685593)
Genome map
AA seq 475 aa AA seqDB search
MSTKQIAIPQDFILGAAASAWQTEGWSGKKPGQDSWIDLWYMNDRHVWHNGYGPAVATDF
INRFREDVALMKQAGLTHYRTSINWSRFLTDYENATVDEEYAAYYDALFDEMHRQGIEPM
ICLEHYELPGVLLETYGGWASKHVVELFVRYAEKVFERFHGKVTRWFTFNEPIVVQTRVY
LDALRWPYEQSTSTWMQWNHHKVLATAKVVKLFREKGYDGTVGCILNPEVTYPRSRAPHD
VRAAEMYDLFYNRVFLDPLVHGRYPQALFTLLAQHQVQWDYTADELALIADNTVDELGIN
LYYPHRVKAPSRAWHPETPFHPAYYYEPFELPGRRMNTSRGWEIFPRIIYDMAMRIKNDY
RNIDWFVAESGMGVENEAQYRNRDGVIDDTYRIEFISEHLYYTLLAREAGANCHGYMLWA
FTDNVSPMNAFKNRYGLIEIDLENQRARRAKKSASWFRQLRDERVLTLRVDDEWK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgagcacaaaacagatagccataccgcaagattttattctgggcgcggcggcatcggcc
tggcagaccgagggctggagcggcaaaaagccggggcaggattcgtggatcgatctctgg
tacatgaacgatcgtcacgtctggcacaacggctatggtccggcggtggcaaccgacttt
atcaatcgcttccgcgaagatgtagcgctgatgaagcaggcgggactgacgcactatcgc
acctcgatcaactggtcgcgctttttaaccgactatgaaaatgcgacggtagatgaagag
tacgccgcgtattacgacgcgctgttcgatgaaatgcaccgtcagggcattgagccgatg
atctgcctggaacactacgaattgccgggcgtgctgctggagacctacggcggctgggcg
tcaaagcacgtcgtcgagctgttcgttcgctatgcggaaaaggtatttgagcgctttcac
ggcaaagtcacccgctggtttaccttcaacgaaccgattgtggtccagacgcgcgtctac
cttgacgcgctgcgctggccctatgagcagagcaccagcacctggatgcagtggaaccac
cataaggtgctggcgacggcgaaagtggtgaagctgtttcgcgagaaagggtatgacggc
acggtgggctgtattcttaacccggaagtgacctatccgcgctcccgcgcgccgcatgac
gtgcgagcggcagagatgtacgatctgttctacaaccgcgtctttctcgacccgctggtg
cacgggcgctatccgcaggcgctctttaccctgctggcgcagcatcaggtgcagtgggac
tacacggctgacgagctggcgctgattgccgacaacaccgtcgatgagctgggcattaac
ctctattacccgcatcgcgtcaaagccccgtcccgcgcctggcacccggagacgccgttc
catccggcgtactactacgagccgtttgagctgcccggacggcgtatgaacacctcccgc
ggctgggagatctttccgcgcattatttacgacatggcgatgcggattaaaaacgactat
cgcaacattgactggtttgtggcggaaagcgggatgggcgtggagaacgaagcgcagtat
cgcaatcgtgacggcgtcattgacgacacgtaccgcatcgagtttatcagcgaacatctc
tactacacgctgctggcgcgggaggcgggggcgaactgtcacggttatatgctgtgggcc
ttcaccgacaatgtctccccgatgaacgcgtttaaaaaccgctacgggctgattgagatc
gaccttgaaaatcaacgcgcacggcgggcaaagaaatcagcgtcctggttccgccagctg
cgcgatgagcgtgtgctgacgctcagggtagacgatgaatggaagtaa

DBGET integrated database retrieval system