KEGG   Enterobacter cloacae ECNIH3: ECNIH3_17470Help
Entry
ECNIH3_17470      CDS       T03350                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ecla  Enterobacter cloacae ECNIH3
Pathway
ecla00071  Fatty acid degradation
ecla00280  Valine, leucine and isoleucine degradation
ecla00310  Lysine degradation
ecla00362  Benzoate degradation
ecla00380  Tryptophan metabolism
ecla00620  Pyruvate metabolism
ecla00630  Glyoxylate and dicarboxylate metabolism
ecla00640  Propanoate metabolism
ecla00650  Butanoate metabolism
ecla00900  Terpenoid backbone biosynthesis
ecla01100  Metabolic pathways
ecla01110  Biosynthesis of secondary metabolites
ecla01120  Microbial metabolism in diverse environments
ecla01130  Biosynthesis of antibiotics
ecla01200  Carbon metabolism
ecla01212  Fatty acid metabolism
ecla02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ecla00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ECNIH3_17470
   00630 Glyoxylate and dicarboxylate metabolism
    ECNIH3_17470
   00640 Propanoate metabolism
    ECNIH3_17470
   00650 Butanoate metabolism
    ECNIH3_17470
  Lipid metabolism
   00071 Fatty acid degradation
    ECNIH3_17470
   00072 Synthesis and degradation of ketone bodies
    ECNIH3_17470
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ECNIH3_17470
   00310 Lysine degradation
    ECNIH3_17470
   00380 Tryptophan metabolism
    ECNIH3_17470
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ECNIH3_17470
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ECNIH3_17470
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ECNIH3_17470
Enzymes [BR:ecla01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ECNIH3_17470
Exosome [BR:ecla04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ECNIH3_17470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AIN24030
Position
complement(3705453..3706631)
Genome map
AA seq 392 aa AA seqDB search
MKDVVIVGALRTAIGCFQGALARHSAVDLGSVVVRALVERSGVAAHEIDEVILGQVLTAG
AGQNPARQAALKGGLPNTVSAITINDVCGSGLKALHLATQAIQCGEADVVIAGGQENMSR
APHVLTDSRTGAQLGNSQLLDSLVHDGLWDAFNDYHMGVTAENLAREYGISRELQDAYAL
SSQQKARAAIDSGRFRDEIVPVSTQRQNGEALIVDTDEQPRTDASAEGLAKLDPAFETLG
SVTAGNASSINDGAAAVMMMSESKAQELALPVLARIKAFASVGVDPALMGIAPVYATRRC
LERAGWQLNDVDLIEVNEAFAAQAISVGKMLEWDPLRVNVNGGAIALGHPIGASGCRILV
SLVHEMKKRNARKGIATLCIGGGQGVALAIER
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgtcgttatagtgggtgcgttacgtacggctatcggctgttttcagggagcg
cttgcgcgtcactctgcggttgatctcggcagcgtggtggtaagagcgctggtggaacgc
agcggggttgccgcacatgaaattgatgaggtgatcctcggccaggtgctgaccgcgggc
gcgggacaaaaccctgcgcgccaggcggcgctgaagggcggcctgcctaataccgtttcg
gcgattaccatcaacgacgtctgtggttcaggtttgaaagcgctccaccttgcgacgcag
gccatccagtgcggtgaagcggacgtggtcattgccggagggcaggaaaacatgagccgc
gccccgcatgtcctgaccgacagccggaccggcgcgcagctcgggaacagtcaactgctt
gacagcctggttcatgacgggctgtgggacgccttcaacgactaccatatgggcgtaacg
gcggaaaacctggcgcgggaatacggcatcagccgcgagcttcaggatgcgtatgcgctt
agctcgcagcaaaaagcgcgtgcagcgatcgactccggccgttttcgcgatgaaattgtc
ccggtcagtacccaacgccagaacggcgaagcgctcatcgttgataccgacgagcagcct
cgcaccgatgccagcgcagaagggctggcaaaactcgatccggccttcgaaacgctcggt
tctgtaacggcaggtaacgcatcatccattaacgacggtgcggcggcggtgatgatgatg
agtgaaagcaaagcccaggagctggcgctgccggtgctggcgcgcatcaaagcgtttgcc
agcgtgggtgttgatcctgcgttaatggggatcgccccggtctatgccacgcgccgctgt
cttgagcgggcgggttggcaactgaacgatgtagatctgattgaagtcaatgaagccttt
gctgcacaggcgatctcggtcgggaaaatgctggaatgggatccgctgcgggtcaacgtc
aacggcggtgcgatcgcgctcggtcatcccattggcgcttccggctgccgcattctggtg
tcgctagtccacgaaatgaaaaagcgtaacgcccgaaaagggatcgcaacgctctgcata
ggcggagggcagggggtagccctggctatcgaacggtaa

DBGET integrated database retrieval system