KEGG   Enterobacter hormaechei subsp. hoffmannii ECNIH3: ECNIH3_18445Help
Entry
ECNIH3_18445      CDS       T03350                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
ecla  Enterobacter hormaechei subsp. hoffmannii ECNIH3
Pathway
ecla00625  Chloroalkane and chloroalkene degradation
ecla00680  Methane metabolism
ecla01100  Metabolic pathways
ecla01120  Microbial metabolism in diverse environments
ecla01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ecla00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    ECNIH3_18445
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ECNIH3_18445
Enzymes [BR:ecla01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     ECNIH3_18445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_N_assoc Glu_dehyd_C AlaDh_PNT_C HI0933_like FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AIN24211
Position
complement(3894650..3895783)
Genome map
AA seq 377 aa AA seqDB search
MKAVIYNGPYDVKVKDVPDAKIVRPTDVLVRITTTNICGSDLHMYEGRTSFEQGRILGHE
NLGEVVEIGSGVERIKVGDYVCLPFNVGCGFCENCEKGLTGFCLTTNPGTAGAAYGFAEM
GPWEGGQAELLRVPFADFNCLVLPPDAAEKEDDYVMLSDIFPTGWHATELAGLKPGESVA
IYGAGPVGLMAAHSAIIKGASQVFVVDTHTDRLALAEKMGATGINATGDEAVQKILDLTD
GRGTDCGCECVGYQCCNKHGHEDNSVTMNSLVASTKATGGIGVVGVFIPQDPGAESELAR
EGKMPFDFGSFWFKGQAIRTGQANVKAYNRQLSRLIHHDKASPGKIISHRLSLEEAPAGY
KHFDERDEGWTKVILKP
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagtaatttacaacggtccttatgatgtaaaagtaaaagacgtaccggatgcg
aaaattgtccgccccacggatgtactcgtccgcatcaccaccaccaacatttgtgggtcg
gacttgcacatgtatgagggccggaccagctttgaacagggacggattctgggtcacgaa
aacctgggtgaagtggtcgaaattggctcaggcgttgaacgtattaaggtgggcgactat
gtttgtctgccgtttaacgtgggatgtggtttttgcgaaaactgtgaaaaaggtctgacc
ggcttttgtctcactaccaatccgggtacggcaggcgcagcttatggttttgctgaaatg
ggtccctgggagggaggtcaggcggaacttcttcgggtgccatttgccgactttaactgc
cttgttcttccccctgatgcggcagaaaaagaagatgattatgtgatgctctctgacatt
tttcctaccggctggcatgcaacagaacttgccggattgaagcctggtgaaagcgtggcc
atttatggcgcggggccggtcggtttgatggcagctcattcggcgatcattaaaggtgct
tcacaggtgtttgtggttgatacgcacacagaccggttggctctggctgaaaaaatgggg
gcgacgggcatcaatgctactggcgatgaagctgtacaaaaaattctcgacctgacggat
ggacgcggtacggattgtggctgcgaatgtgttggctatcagtgctgtaacaaacatggc
catgaagataactctgttaccatgaacagtcttgttgcgtcgacgaaagcaaccggggga
attggtgtggttggcgtctttattcctcaggatccgggggctgaatcggagcttgccaga
gagggtaagatgccatttgattttgggagtttctggtttaaaggacaggcaatccgtacc
ggccaggcgaacgttaaggcctataaccgtcagctgtctcgcctcatccatcacgataaa
gccagtccgggcaaaataatttctcatcgtctttcgcttgaagaggctcctgccggatat
aagcacttcgatgagcgggatgaaggatggacgaaggttatccttaagccttaa

DBGET integrated database retrieval system