KEGG   Enterobacter hormaechei subsp. hoffmannii ECR091: ECR091_10535Help
Entry
ECR091_10535      CDS       T03378                                 

Definition
(GenBank) succinate dehydrogenase
  KO
K08324  succinate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.24]
Organism
eclc  Enterobacter hormaechei subsp. hoffmannii ECR091
Pathway
eclc00250  Alanine, aspartate and glutamate metabolism
eclc00650  Butanoate metabolism
eclc00760  Nicotinate and nicotinamide metabolism
eclc01100  Metabolic pathways
eclc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eclc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ECR091_10535
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ECR091_10535
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    ECR091_10535
Enzymes [BR:eclc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     ECR091_10535
    1.2.1.24  succinate-semialdehyde dehydrogenase (NAD+)
     ECR091_10535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AIN28081
Position
2233532..2234914
Genome map
AA seq 460 aa AA seqDB search
MTYSSATHAHSVNPATGETLAAYPWATSGDVERAIAQADTGFRQWRRESVAHRAQKLRDL
GAALRSRAEEMAQTISREMGKPIVQARAEVAKSASLCDWYAEYGPAMLRPESTQVDNAVI
EYRPLGPILAVMPWNFPLWQVLRGAVPILLAGNSYLLKHAPNVLGSAELIGKVFADAGFP
EGIFGWVNATNDGVSQAINDRRIAAVTVTGSVRAGAAIGAQAGAALKKCVLELGGSDPFI
VLNDADLDLAVNAAVAGRYQNTGQVCAAAKRFIVEAGVADTFTQRFVDAVKALKMGAPDE
EDNYIGPMARFDLRDELHQQVQATLAEGATLLLGGEKLAGTGNYYAPTVLGDVTPQMTAF
RQELFGPVAAITVANDASHALQLANDSDFGLSATVFTANDALAETFSRELECGGVFINGY
SASDARVAFGGVKKSGFGRELSHFGLHEFCNVQTVWKDRV
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgacgtattcatctgctacccatgcccactctgtcaacccggctaccggcgaaacgctg
gctgcttacccgtgggcaacgtccggtgacgttgagcgtgccattgcgcaggcggatacc
ggttttcgtcagtggcgacgcgaaagcgtggcgcaccgggcgcaaaaacttcgcgatcta
ggtgcggcgctgcgtagccgtgcggaagagatggcgcagactatctcccgggagatgggc
aagcccattgtgcaggcgcgtgcggaggtggctaagtccgccagcctttgcgactggtac
gctgaatacggcccggcaatgctgcgcccggaatctacccaggtcgacaatgcggtgatt
gagtaccgtccgctggggcctattctggcggtgatgccgtggaacttcccgctctggcag
gtgctgcgcggtgcggtgccgatcctgctggcagggaacagctatctgcttaaacatgcg
ccaaatgtgctcggctcggcggagctgatcgggaaggtgttcgcggatgccggtttcccg
gaggggatctttggctgggtgaacgcgacaaatgacggcgtcagccaggcgattaacgat
cggcgtatcgcggcggtgaccgtaaccggcagcgttagggctggtgcggcaattggcgcg
caggcgggcgcggcgctgaagaaatgcgtgctggagctgggcggctccgatccgtttatc
gttctgaatgatgccgatctggatctggctgtcaacgcggccgtggccggacgttatcag
aataccggacaagtttgcgcggcggcgaaacgctttattgtggaagcgggcgtggcggac
acctttacccaacgctttgttgacgcggtcaaggcgctgaaaatgggcgcaccggatgag
gaagataactatattggcccgatggcgcgatttgatcttcgcgatgaactgcatcagcag
gtacaggctacgctggcggaaggggcgaccctgctgctcggcggcgagaagcttgccggg
accggtaactattatgcgccaaccgtactcggcgacgtcaccccacagatgacggccttc
cgtcaggagctgtttggcccggtggccgcgattaccgtcgccaatgatgcgtcgcacgcg
ttgcagctggctaacgacagcgactttggcttatcagcgacggtctttaccgcgaacgat
gcgctggctgaaaccttctctcgcgagctggagtgcggcggagtctttatcaatggctac
agcgcaagcgatgcgcgcgttgcgtttggcggagtgaagaagagcggcttcgggcgagag
ctttcacatttcggtctgcatgagttctgtaacgttcagacggtctggaaggatcgcgtg
taa

DBGET integrated database retrieval system