KEGG   Enterobacter cloacae ECR091: ECR091_10800Help
Entry
ECR091_10800      CDS       T03378                                 

Definition
(GenBank) glycosyl hydrolase family 32
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
eclc  Enterobacter cloacae ECR091
Pathway
eclc00052  Galactose metabolism
eclc00500  Starch and sucrose metabolism
eclc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eclc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    ECR091_10800
   00500 Starch and sucrose metabolism
    ECR091_10800
Enzymes [BR:eclc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     ECR091_10800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: AIN28134
Position
complement(2294352..2295758)
Genome map
AA seq 468 aa AA seqDB search
MTLPSRWPAVLQAVMQGQPRALADSHYPQWHPAPVTGLMNDPNGFIWFAERYHLFYQWNP
LGCDHRYKCWGHWSSADLVHWQHEPMALMPDEEYDRNGCYSGSAVDNNGVLTLCYTGNVK
FDDGGRTAWQCLAVQNDDGTFAKLGPVLPLPDGYTGHVRDPKVWRHDGQWYMVLGAQDQH
KRGKVLLFTSADLHTWASCGEIAGHGVNGLTDAGYMWECPDLFALDGTHVLICCPQGLAR
EPHRYLNTYPAVWMSGAFDYQTPAFAHDELHELDAGFEFYAPQTTVAEDGRRILIGWMGV
PDGEEMLQPTRGHGWIHQMTCPRELRYRDGKLWQTPVRELETLREDEHHWQGRASDAPVL
EGTRLEFELSASCVKVDFAGALRLIVDDAGIRLERASLETGETLTRYWQGSVHHLRVLCD
RSSVEIFINHGEGVMSSRYFPDHPAQVRFEGASDITLRYWSLRSCMIE
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgaccttaccttcccgctggcctgccgtgttgcaggccgttatgcaaggccagccgcgt
gcgctggcggacagccactatccgcagtggcatcccgcaccggtgacagggctgatgaac
gatccgaacggctttatctggtttgccgaacgttaccatctgttttatcagtggaacccg
ctgggctgcgatcatcgctacaagtgctggggacactggagctcagcagatctggtgcac
tggcagcacgagccaatggcgctgatgcctgacgaagagtatgaccgcaatggctgttac
tccggcagcgccgtggataacaacggcgtgctgaccctgtgctataccggcaacgttaag
tttgacgatggcggccgcaccgcctggcagtgtctggcggtgcaaaatgacgacggcacg
tttgccaaactgggaccggtgttgcccctgccggacgggtataccgggcacgtccgcgac
ccgaaagtgtggcgccatgacgggcagtggtacatggtgctcggggcgcaggatcagcat
aagcgcggcaaggtgctgctgtttacgtcagccgatttgcacacctgggcgtcctgcggc
gaaatcgctggtcacggcgtcaacggactcacggacgcgggctatatgtgggagtgcccg
gatctgtttgcgcttgatggcacacacgtcttgatctgctgcccacaggggctggcgcgc
gaaccgcatcgctatctcaacacctatccggccgtctggatgagtggggcatttgattat
caaacgcctgcatttgcgcacgacgaattgcatgagcttgatgccggtttcgaattttac
gcgccgcaaaccacggtggcagaagatggccgccgcatcctcatcggctggatgggcgtg
ccggacggcgaagagatgctccagcctacacgggggcacggctggatccaccagatgacc
tgtccgcgcgagctgcgctaccgcgacggtaagctctggcaaacgccggtccgtgagctg
gaaacgctgcgcgaggatgaacatcactggcagggacgcgccagcgatgccccggtgctg
gagggaacccgtcttgagttcgaactgagcgcatcgtgcgtaaaagtggattttgccggc
gcgttgcggctgattgtggatgatgcggggatccgtctggaacgcgccagcctggaaacc
ggagagacgttgacccgctactggcagggctctgttcatcatttacgcgtgctgtgtgac
cgttccagcgtcgaaattttcatcaatcacggtgaaggcgtcatgagcagccgctatttt
cctgaccatccggcccaggttcgcttcgaaggtgcgtccgacatcacattacgctactgg
tcgctgcgcagctgcatgatagaatag

DBGET integrated database retrieval system