KEGG   Enterobacter hormaechei subsp. hoffmannii ECR091: ECR091_14465Help
Entry
ECR091_14465      CDS       T03378                                 

Definition
(GenBank) beta-D-glucoside glucohydrolase
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
eclc  Enterobacter hormaechei subsp. hoffmannii ECR091
Pathway
eclc00460  Cyanoamino acid metabolism
eclc00500  Starch and sucrose metabolism
eclc01100  Metabolic pathways
eclc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eclc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ECR091_14465
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    ECR091_14465
Enzymes [BR:eclc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     ECR091_14465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 Glyco_hydro_3_C Fn3-like SBD_N CARDB
Motif
Other DBs
NCBI-ProteinID: AIN28815
Position
complement(3062736..3065033)
Genome map
AA seq 765 aa AA seqDB search
MKWLCYVGVAVSLALQPALAEDLFGNHPLTPEARDAFVTDLLKKMTVDEKIGQLRLISVG
PDNPKEAIREMIKDGQVGAIFNTVTRQDIRKMQDQVMELSRLKIPLFFAYDVVHGQRTVF
PISLGLASSFNLDAVKTVGRVSAYEAADDGLNMTWAPMVDVSRDPRWGRASEGFGEDTYL
TATMGKTMVEAMQGKSPADRYSVMTSVKHFAAYGAVEGGKEYNTVDMSPQRLFNDYMPPY
KAGLDAGSGAVMVALNSLNGTPATSDSWLLKDVLRDQWGFKGITVSDHGAIKELIKHGTA
SDPEDAVRVALKSGINMSMSDEYYSKYLPGLVKSGKVTMAELDDAARHVLNVKYDMGLFN
DPYSHLGPKESDPADTNAESRLHRKEAREVARESLVLLKNRLDTLPLKKSGTIAVIGPLA
DSKRDVMGSWSAAGVADQSVTVLTGIKSAVGDNAKVVYAKGANVTDDKDIVTFLNQYEEA
VKVDPRTPKEMIDEAVNAAKQSDVVVAVVGEAQGMAHEASSRTDITIPQSQRDLIAALKA
TGKPLVLVLMNGRPLALVKEDQQADAILETWFAGTEGGNAIADVLFGDYNPSGKLPMSFP
RSVGQIPVYYSHLNTGRPYNADKPNKYTSRYFDEANGPLYPFGYGLSYTTFKVSDVKMSA
PTLKRDGKVTASVEVTNSGKREGATVIQMYVQDVTASMSRPVKQLRGFEKVNLKPGETKT
VSFPIDVNALKFWNQQMKYDAEPGKFNVFIGVDSARVNKAEFELQ
NT seq 2298 nt NT seq  +upstreamnt  +downstreamnt
atgaaatggctatgttatgtaggtgtcgccgtcagcctggcgctgcaacctgcgctggca
gaggatttgtttggtaatcacccgctcacgcctgaagcccgcgacgcctttgtcacggat
ttactcaaaaagatgacggtcgatgagaaaatcggccagctgcgcctgataagcgtcggc
ccggataacccgaaagaagccattcgcgagatgatcaaagacgggcaggtaggagccatt
tttaacaccgttacccgccaggatatccgcaaaatgcaggatcaggtgatggaactgagc
cgcctgaaaattccgctgttcttcgcctacgacgtggtgcacggccagcgtaccgtcttc
ccgattagcctcggcttagcctcctcttttaatcttgatgcggtgaaaaccgtcgggcgc
gtatcggcatatgaagccgcagacgacggcctgaacatgacctgggcgccgatggtagac
gtctcccgcgatccgcgctggggccgtgcttcggagggctttggggaagatacttattta
accgccacgatgggcaaaaccatggtggaagcgatgcagggcaaaagtccggcagatcgt
tactcggtgatgaccagcgtcaagcacttcgccgcctatggcgcggtggaaggcggcaaa
gagtacaacaccgtggacatgagcccgcagcgcctgtttaacgactatatgccgccgtac
aaagcggggctggacgcgggcagcggcgcggtgatggtggcgttgaactctctcaacggc
acgcctgccacctccgattcgtggctgctgaaagatgtgctgcgcgaccagtggggcttc
aagggcatcaccgtttcggatcacggggcgattaaagagctgatcaagcacggcacagcg
tctgacccggaagatgcggtacgcgtggcactcaagtccggcatcaacatgagcatgagc
gacgaatactacagcaaatacctgccggggctggtgaagagcggcaaggtgacgatggcg
gagctggacgatgccgctcgccacgtgctgaacgtgaaatatgacatggggctgtttaac
gatccttacagccatctggggccgaaggagtctgacccggcagacaccaatgctgaaagc
cgcctgcaccgcaaagaagcccgcgaagtggcgcgcgaaagcctggtgctgctgaaaaac
cgtctcgacacgctgccgctgaaaaaatccggcaccattgccgtgatcggtccgctggcc
gacagcaagcgtgacgtcatgggcagctggtccgccgcaggcgtggcggatcagtccgtt
accgtgctgacaggcattaagagcgccgtgggtgataatgcaaaagtggtttacgccaaa
ggcgcaaacgtcaccgacgataaagacatcgtgaccttcctcaaccagtacgaggaagcg
gtgaaggtggatccacgcacgccgaaagagatgatcgacgaagcggttaacgccgcgaag
cagtccgacgtggtggtcgccgtggtgggtgaagcgcaggggatggcgcacgaagcctcc
agccggaccgacatcacgatcccgcaaagccagcgtgacctgatcgcggccctgaaagcc
accggcaagccgctggtgctggtgctgatgaacgggcgtccgctggcgctggtgaaagaa
gaccagcaggctgacgccattctggaaacctggttcgccggtaccgaaggcggtaacgcc
attgccgacgtgctgtttggcgattataacccgtccggcaagctgccgatgtccttcccg
cgctccgtcgggcagatcccggtttactacagccacctgaacaccggtcgtccgtacaac
gccgataagccgaacaagtacacgtcccgttacttcgacgaggctaacggcccgctctat
ccgtttggctatggcctgagctacaccacgtttaaggtctctgacgtgaaaatgtcggcg
ccgaccctgaagcgtgacggcaaagtgaccgccagcgtggaagtgaccaacagcggtaaa
cgcgaaggcgcaacggtgatccagatgtacgttcaggatgtcacggcctccatgagccgt
ccggtgaaacagctgcgcggcttcgaaaaggtcaacctgaaaccgggcgaaaccaaaacg
gtcagcttcccgattgacgtaaatgcgctgaagttctggaatcagcagatgaaatacgat
gccgagcctggcaaattcaacgtcttcatcggcgtggattccgcccgcgtgaacaaagcc
gagttcgaactgcaataa

DBGET integrated database retrieval system