KEGG   Enterobacter hormaechei subsp. hoffmannii ECR091: ECR091_15795Help
Entry
ECR091_15795      CDS       T03378                                 

Definition
(GenBank) nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
eclc  Enterobacter hormaechei subsp. hoffmannii ECR091
Pathway
eclc00230  Purine metabolism
eclc00240  Pyrimidine metabolism
eclc01100  Metabolic pathways
eclc01110  Biosynthesis of secondary metabolites
eclc01130  Biosynthesis of antibiotics
Module
eclc_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
eclc_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
eclc_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
eclc_M00053  Pyrimidine deoxyribonuleotide biosynthesis, CDP/CTP => dCDP/dCTP,dTDP/dTTP
Brite
KEGG Orthology (KO) [BR:eclc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ECR091_15795
   00240 Pyrimidine metabolism
    ECR091_15795
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:eclc04131]
    ECR091_15795
Enzymes [BR:eclc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     ECR091_15795
Membrane trafficking [BR:eclc04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    ECR091_15795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: AIN29069
Position
complement(3357430..3357861)
Genome map
AA seq 143 aa AA seqDB search
MAIERTFSIIKPNAVAKNVIGSIFARFESAGFKIVGTKMLHLTVEQARGFYAEHEGRPFF
DGLVEFMTSGPIVVSVLEGENAVQRHRDLLGATNPDNALAGTLRADYADSFTENGTHGSD
SVESAAREIAFFFAEGEVCPRTR
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atggctattgaacgtactttttccatcatcaaaccaaacgcggtggcaaaaaacgttatt
ggcagcatcttcgctcgctttgaatcagcagggtttaagatcgttggcaccaaaatgctg
cacctgaccgttgaacaggctcgcggtttctacgctgagcacgaaggtcgcccattcttt
gacggtctggtcgagttcatgacttctggcccaatcgtggtatccgtactggaaggcgaa
aacgcggtacagcgtcaccgcgatctgctgggtgcaaccaacccggacaacgcgctggca
ggtactctgcgcgctgactacgcagacagcttcaccgagaacggcacccacggttccgac
tctgttgaatctgctgcgcgcgaaatcgcgttcttctttgcagaaggcgaagtgtgcccg
cgcactcgctaa

DBGET integrated database retrieval system