KEGG   Enterobacter hormaechei subsp. hoffmannii ECR091: ECR091_17405Help
Entry
ECR091_17405      CDS       T03378                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
eclc  Enterobacter hormaechei subsp. hoffmannii ECR091
Pathway
eclc00071  Fatty acid degradation
eclc00280  Valine, leucine and isoleucine degradation
eclc00310  Lysine degradation
eclc00362  Benzoate degradation
eclc00380  Tryptophan metabolism
eclc00620  Pyruvate metabolism
eclc00630  Glyoxylate and dicarboxylate metabolism
eclc00640  Propanoate metabolism
eclc00650  Butanoate metabolism
eclc00900  Terpenoid backbone biosynthesis
eclc01100  Metabolic pathways
eclc01110  Biosynthesis of secondary metabolites
eclc01120  Microbial metabolism in diverse environments
eclc01130  Biosynthesis of antibiotics
eclc01200  Carbon metabolism
eclc01212  Fatty acid metabolism
eclc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:eclc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ECR091_17405
   00630 Glyoxylate and dicarboxylate metabolism
    ECR091_17405
   00640 Propanoate metabolism
    ECR091_17405
   00650 Butanoate metabolism
    ECR091_17405
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ECR091_17405
   00072 Synthesis and degradation of ketone bodies
    ECR091_17405
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ECR091_17405
   00310 Lysine degradation
    ECR091_17405
   00380 Tryptophan metabolism
    ECR091_17405
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ECR091_17405
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ECR091_17405
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ECR091_17405
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:eclc04147]
    ECR091_17405
Enzymes [BR:eclc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ECR091_17405
Exosome [BR:eclc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ECR091_17405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AIN29369
Position
complement(3693430..3694608)
Genome map
AA seq 392 aa AA seqDB search
MKDVVIVGALRTAIGCFQGALARHSAVDLGSVVVRALVERSGVAAHEIDEVILGQVLTAG
AGQNPARQAALKGGLPNTVSAITINDVCGSGLKALHLATQAIQCGEADVVIAGGQENMSR
APHVLTDSRTGAQLGNSQLLDSLVHDGLWDAFNDYHMGVTAENLAREYGISRELQDAYAL
SSQQKARAAIDSGRFRDEIVPVSTQRQNGEALIVDTDEQPRTDASAEGLAKLDPAFETLG
SVTAGNASSINDGAAAVMMMSESKAQELALPVLARIKAFASVGVDPALMGIAPVYATRRC
LERAGWQLNDVDLIEVNEAFAAQAISVGKMLEWDPLRVNVNGGAIALGHPIGASGCRILV
SLVHEMKKRNARKGIATLCIGGGQGVALAIER
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgtcgttatagtgggtgcgttacgtacggctatcggctgttttcagggagcg
cttgcgcgtcactctgcggttgatctcggcagcgtggtggtaagagcgctggtggaacgc
agcggggttgccgcacatgaaattgatgaggtgatcctcggccaggtgctgaccgcgggc
gcgggacaaaaccctgcgcgccaggcggcgctgaagggcggcctgcctaataccgtttcg
gcgattaccatcaacgacgtctgtggttcaggtttgaaagcgctccaccttgcgacgcag
gccatccagtgcggtgaagcggacgtggtcattgccggagggcaggaaaacatgagccgc
gccccgcatgtcctgaccgacagccggaccggcgcgcagctcgggaacagtcaactgctt
gacagcctggttcatgacgggctgtgggacgccttcaacgactaccatatgggcgtaacg
gcggaaaacctggcgcgggaatacggcatcagccgcgagcttcaggatgcgtatgcgctt
agctcgcagcaaaaagcgcgtgcagcgatcgactccggccgttttcgcgatgaaattgtc
ccggtcagtacccaacgccagaacggcgaagcgctcatcgttgataccgacgagcagcct
cgcaccgatgccagcgcagaagggctggcaaaactcgatccggccttcgaaacgctcggt
tctgtaacggcaggtaacgcatcatccattaacgacggtgcggcggcggtgatgatgatg
agtgaaagcaaagcccaggagctggcgctgccggtgctggcgcgcatcaaagcgtttgcc
agcgtgggtgttgatcctgcgttaatggggatcgccccggtctatgccacgcgccgctgt
cttgagcgggcgggttggcaactgaacgatgtagatctgattgaagtcaatgaagccttt
gctgcacaggcgatctcggtcgggaaaatgctggaatgggatccgctgcgggtcaacgtc
aacggcggtgcgatcgcgctcggtcatcccattggcgcttccggctgccgcattctggtg
tcgctagtccacgaaatgaaaaagcgtaacgcccgaaaagggatcgcaacgctctgcata
ggcggagggcagggggtagccctggctatcgaacggtaa

DBGET integrated database retrieval system