KEGG   Enterobacter hormaechei subsp. hoffmannii ECR091: ECR091_19345Help
Entry
ECR091_19345      CDS       T03378                                 

Definition
(GenBank) sensor protein BasS/PmrB
  KO
K07643  two-component system, OmpR family, sensor histidine kinase BasS [EC:2.7.13.3]
Organism
eclc  Enterobacter hormaechei subsp. hoffmannii ECR091
Pathway
eclc01503  Cationic antimicrobial peptide (CAMP) resistance
eclc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:eclc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ECR091_19345
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    ECR091_19345
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:eclc01001]
    ECR091_19345
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:eclc02022]
    ECR091_19345
Enzymes [BR:eclc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     ECR091_19345
Protein kinases [BR:eclc01001]
 Histidine kinases
  OmpR family
   ECR091_19345
Two-component system [BR:eclc02022]
 OmpR family
  BasS-BasR (antimicrobial peptide resistance)
   ECR091_19345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA HAMP HATPase_c_2 HATPase_c_5
Motif
Other DBs
NCBI-ProteinID: AIN29733
Position
4086854..4087897
Genome map
AA seq 347 aa AA seqDB search
MNSMRRRLMVLLAVILLFFQLVSVVWLWHESREQIGFLVNETLSAKARNNHVEKEIREAI
ASLLVPSLVMVGFTLLFSFWAVTWITRPLNKLRVSLANRSADNLTPLPMYSDMEEIGAVT
TSLNQLLARLDHTIQQERLFTADAAHELRTPLAGIRLHLELMAQSGSPQATPLINRIDQL
MHTVEQLLMLARAGQAMASGHYDTVNWTETIIAPLSLEHEAKEHTVIWPAHSALTVQGDA
VLLRLMLRNLLENAARYSPAGTTIEVALTATESGTRVSVIDQGPGIDEAHRQSITEPFRR
LDQRYGGSGLGLSIVQRIVQLHHGNLTLENGDEGGLIASCWLPAKIG
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaacagtatgcgccggcgattaatggtgttgctggcggttatactgctattttttcaa
ctggttagcgtagtctggctgtggcatgagagccgcgagcaaatcggttttctggtgaat
gaaacgttgtctgcgaaagcgcgcaacaaccatgtcgaaaaagagatccgcgaagccatt
gcctccctgctggtcccttctctggtgatggtcggttttaccctgctcttctcattctgg
gccgtcacctggatcacccgaccactcaacaaacttcgcgtcagccttgcgaaccgttcg
gcggataatctgactcccctgccgatgtattctgatatggaagagataggcgctgtgacc
acatcgctcaatcaactcctcgcccggctggatcacactattcaacaggaacgcctgttt
accgccgatgcggcacacgagttacgtacgccgcttgcggggatcaggctccatctggaa
ctgatggctcagtccggttccccgcaggccacaccactgataaaccggatcgatcagttg
atgcacacggtggaacagctgctgatgctggcgcgtgccggacaggcgatggccagcggc
cattacgataccgtgaactggactgagacgatcattgctccgcttagcctggagcatgaa
gccaaagagcatacggtgatatggccggcccacagcgcgctgacggttcagggggacgcc
gtcctgttacgtctgatgctaaggaaccttctggagaatgccgcccgctacagcccggca
ggcacaaccattgaagtggcattaacagcgacggagagcggtacccgggtgagcgttatc
gatcaggggccgggtattgatgaggcacaccgccagtcgatcaccgaacctttccgacgt
ctcgaccagcgctacggcggcagcggccttgggctgagcatcgtacagcgtatcgtacag
ctccatcatggcaatttaacgctggagaacggcgatgagggcggcctcatcgccagctgt
tggttaccggcgaaaataggataa

DBGET integrated database retrieval system