KEGG   Enterobacter hormaechei subsp. hoffmannii ECR091: ECR091_20020Help
Entry
ECR091_20020      CDS       T03378                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
eclc  Enterobacter hormaechei subsp. hoffmannii ECR091
Pathway
eclc03010  Ribosome
Brite
KEGG Orthology (KO) [BR:eclc00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    ECR091_20020
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:eclc03011]
    ECR091_20020
Ribosome [BR:eclc03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    ECR091_20020
  Bacteria
    ECR091_20020
  Archaea
    ECR091_20020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AIN29859
Position
complement(4212370..4212702)
Genome map
AA seq 110 aa AA seqDB search
METLAQHRHARSSAQKVRLVADLIRGKKVSQALDILTYTNKKAAVLVKKVLESAIANAEH
NDGADIDDLKVAKIFVDEGPSMKRIMPRAKGRADRILKRTSHITVVVSDR
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaaactttagctcaacatcgccatgctcgttcttctgcacagaaggttcgccttgtt
gctgacctgattcgcggtaagaaagtgtcgcaggccctggacatcctgacctataccaac
aagaaagctgcggtattggtcaagaaagtactggaatctgccattgctaacgctgaacac
aacgatggcgctgacatcgacgatctgaaagtcgcgaaaattttcgtagatgaaggccca
agcatgaagcgcattatgccgcgtgcgaaaggtcgtgcagatcgcatcctgaagcgcacc
agccacattactgtggttgtgtccgatcgctga

DBGET integrated database retrieval system