KEGG   Enterobacter cloacae ECNIH2: ECNIH2_01615Help
Entry
ECNIH2_01615      CDS       T03471                                 

Definition
(GenBank) lysophospholipase L2
  KO
K01048  lysophospholipase [EC:3.1.1.5]
Organism
ecle  Enterobacter cloacae ECNIH2
Pathway
ecle00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ecle00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    ECNIH2_01615
Enzymes [BR:ecle01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     ECNIH2_01615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 LIDHydrolase PGAP1
Motif
Other DBs
NCBI-ProteinID: AIE62109
Position
328147..329139
Genome map
AA seq 330 aa AA seqDB search
MFQQKKDWETRENAFAAFSMGPLTDFWRQREEDEFMGVGEIPVRFVRFRDEKNDRVIVVC
PGRIESYIKYAELAYDLFHLGFDVLIIDHRGQGLSGRMLPDTHRGHVDNFSDYVDDLAAF
WQQEVQPGPWRKRYILAHSMGGAISTLFLQRHKHQCDAIALTAPMYGIVIRFPDWMVRHL
LDWAEGHQRIREGYAIGTGRWRALPFAINVLTHSRQRYRRNLRFYADEPRLRVGGPTWHW
VREGIHAGEQVLAGVGDDDTPTLLIQAEEERVVDNRMHDRYCELRAAAGHPCEGGKPLVI
NGAYHEILFEKDAMRSVALNAIVEFFNRHN
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgtttcagcagaaaaaggactgggaaacacgagaaaacgcatttgctgctttctccatg
gggccgctgaccgatttctggcgccagcgtgaggaagatgagtttatgggcgtcggggaa
atcccggtacgcttcgttcgtttccgtgatgaaaaaaatgaccgggtgattgtggtctgc
cccgggcgcatcgaaagctatatcaaatatgccgagttggcgtatgacctgttccatctg
ggctttgatgtgttaattatcgaccatcgcgggcaggggctttctggcaggatgttgccg
gatacccatcgcggccacgtggataacttcagcgattacgtcgacgatctggccgcgttc
tggcagcaggaagtgcagcccggaccgtggcgcaagcgttatattcttgcccactccatg
gggggcgcgatctcgacgttgtttttgcagcgccataagcaccagtgtgacgccattgcg
ctgaccgcgccgatgtacggcattgtgatacgttttcctgactggatggtgcgccatctg
ctggactgggctgagggccatcagcgcattcgagaaggctatgccatcggaacaggacgc
tggcgggcattgccatttgccatcaacgtgttaacccacagccggcagcgttatcgccgc
aacctgcgtttttatgccgatgaaccgcgtctgcgggtcggcggccccacctggcactgg
gtgcgggaaggtattcatgccggtgagcaggtgctggcgggcgtaggcgatgatgacacg
ccgacgctcctgatccaggcggaagaagagcgtgtggtggataaccgcatgcatgaccgc
tattgtgaacttcgcgccgctgcgggccatccctgtgaagggggtaaaccgctggtcatc
aacggtgcgtaccatgagatcctttttgaaaaggacgctatgcgctcagtcgcgctcaac
gccattgttgaatttttcaacaggcataactga

DBGET integrated database retrieval system