KEGG   Enterobacter cloacae ECNIH2: ECNIH2_08040Help
Entry
ECNIH2_08040      CDS       T03471                                 

Definition
(GenBank) nitroreductase A
  KO
K10678  nitroreductase [EC:1.-.-.-]
Organism
ecle  Enterobacter cloacae ECNIH2
Pathway
ecle00633  Nitrotoluene degradation
ecle01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ecle00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    ECNIH2_08040
Enzymes [BR:ecle01000]
 1. Oxidoreductases
  1.-  
   1.-.-  
    1.-.-.-  
     ECNIH2_08040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitroreductase
Motif
Other DBs
NCBI-ProteinID: AIE63314
Position
1674709..1675431
Genome map
AA seq 240 aa AA seqDB search
MTPTIDLLRSHRSIRHFTDEPITQAQREAIIDSARGTSSSSFLQCSSIIRITDPAMREQL
VTLTGGQKHVAQAAEFWVFCADFNRHLQICPEAELGLAEQLLLGVVDTALMAQNAFTAAE
SLGLGGVYIGGLRNNIESVTELLKLPKHVLPLFGLCLGWPADNPDLKPRIPAAMLVHENH
YQPVDQDVLHQYDEELANYYLTRDSNNRRDTWSDHIRRTIIKENRPFILDYLHKQGWATR
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgacgccaaccattgacctgcttcgttcccaccgttccattcgccatttcaccgatgag
ccgattacccaggcgcagcgggaagcgatcatcgacagcgcaagaggcacctccagctcc
agctttttgcagtgcagctccattatccgcatcaccgatccggcgatgcgtgagcagctg
gtaacgctgacgggcggacaaaagcacgttgcccaggcggctgagttctgggtgttctgc
gccgattttaaccgtcatctgcaaatctgccccgaggccgagctggggctggcggaacag
ctgctgctgggcgtggtggatacggcgctgatggcgcaaaacgcgttcacggcggcggaa
tcgctggggcttggcggcgtctatattggcgggctgcgtaacaacatcgaaagcgtgacg
gaactgctgaagctgccgaaacacgtgctgccgctgtttggtctgtgcctcggctggccg
gcggataacccggatctgaagccgcgcattcctgctgcgatgctggtgcatgaaaaccac
taccagccggtcgaccaggacgttctgcatcaatacgatgaagagctggcgaactactat
ctgacgcgcgacagcaacaaccgccgcgacacctggagcgaccatattcgtcgcaccatc
atcaaggagaaccgcccgttcattcttgattacctgcacaaacagggctgggcaacgcgg
tag

DBGET integrated database retrieval system