KEGG   Enterobacter cloacae ECNIH2: ECNIH2_16055Help
Entry
ECNIH2_16055      CDS       T03471                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
ecle  Enterobacter cloacae ECNIH2
Pathway
ecle00430  Taurine and hypotaurine metabolism
ecle00620  Pyruvate metabolism
ecle00640  Propanoate metabolism
ecle00680  Methane metabolism
ecle01100  Metabolic pathways
ecle01120  Microbial metabolism in diverse environments
ecle01200  Carbon metabolism
Module
ecle_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:ecle00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ECNIH2_16055
   00640 Propanoate metabolism
    ECNIH2_16055
  09102 Energy metabolism
   00680 Methane metabolism
    ECNIH2_16055
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    ECNIH2_16055
Enzymes [BR:ecle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     ECNIH2_16055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: AIE64840
Position
3333082..3334284
Genome map
AA seq 400 aa AA seqDB search
MSSKLVLVLNCGSSSLKFAIIDALNGDEYLSGLAECFHLPEARIKWKMDGSKQEAALGAG
AAHSEALNFIVNTILAQKPELSAQLTAIGHRIVHGGEKYTSSVVIDDSVIQGIKDSASFA
PLHNPAHLIGIAEALKSFPSLKDKNVAVFDTAFHQTMPEESYLYALPYSLYKEHGVRRYG
AHGTSHFYVTQEAAKVLNKPVEEVNIITCHLGNGGSVSAIRNGKCVDTSMGLTPLEGLVM
GTRSGDIDPAIIFHLHDTLGMSVDDINKMLTKESGLLGLTEVTSDCRYVEDNYAEKADAK
RAMDVYCHRLAKYIGSYTALMEGRLDAVIFTGGIGENAAMVRELSLGKLGVLGFEVDHER
NLAARFGKSGFINKEGTRPAIVIPTNEELVIAQDAHRLTA
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagtaagttagtactggttctgaactgcggtagctcctcactgaaattcgccatc
atcgatgcgctcaacggtgacgagtacctctctggtttggccgaatgtttccatctgcct
gaagcacgtatcaagtggaagatggacggcagcaaacaagaagcggctttaggtgcaggc
gccgctcacagtgaagcgctgaactttatcgttaacactattctggcacaaaaaccagaa
ctgtctgctcagctgaccgcaattggtcaccgtatcgtccacggcggcgaaaaatacacc
agttccgtggtaatcgacgactccgtgatccagggtatcaaagactctgcgtctttcgca
ccgctgcataacccggctcacctgatcggtatcgctgaagcactgaaatccttcccgagt
ctgaaagataaaaacgtggccgtgtttgataccgcgttccatcagaccatgccggaagag
tcttacctctatgccctgccatacagcctgtacaaagagcacggcgtccgtcgttacggc
gctcacggtaccagccacttctatgtgactcaggaagccgcaaaagtgctgaacaagccg
gttgaagaagtcaacatcatcacctgccacctgggcaacggtggttctgtttccgctatc
cgcaacgggaagtgtgttgacacctctatgggtctgaccccgctggaaggtctggtgatg
ggtacccgttccggtgatatcgacccggcgatcatcttccacctgcacgacaccctgggc
atgagcgttgacgacatcaacaaaatgctgaccaaagagtctggcctgctgggcctgacc
gaggtcaccagcgactgccgttacgttgaagacaactacgcagaaaaagctgacgctaaa
cgtgcaatggacgtttattgccaccgtctggcgaagtacatcggttcttacaccgcgctg
atggaaggccgtctggatgctgttatcttcaccggcggtatcggtgagaacgcggcaatg
gtacgtgaactgtccctgggcaaactgggcgttctgggcttcgaagttgatcatgagcgt
aacctggctgcccgcttcggcaagtctggcttcatcaacaaagaaggcacccgccctgct
atcgttatcccaactaacgaagagctggtcatcgcgcaagacgcgcaccgcctgactgcc
tga

DBGET integrated database retrieval system