KEGG   Enterobacter cloacae ECNIH2: ECNIH2_18350Help
Entry
ECNIH2_18350      CDS       T03471                                 

Definition
(GenBank) 23S rRNA methyltransferase
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
ecle  Enterobacter cloacae ECNIH2
Brite
KEGG Orthology (KO) [BR:ecle00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ecle03009]
    ECNIH2_18350
Enzymes [BR:ecle01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     ECNIH2_18350
Ribosome biogenesis [BR:ecle03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    ECNIH2_18350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RlmM_FDX FtsJ DUF4222 MIT_C Spt5-NGN
Motif
Other DBs
NCBI-ProteinID: AIE65272
Position
complement(3805215..3806315)
Genome map
AA seq 366 aa AA seqDB search
MNKVVLYCRPGFEKECAAEITDKAAKREVFGFARVKENAGYVVFECYQPDDADKLARELP
FSSLIFARQMFVAGELLKDLPPEDRITPIVGLLQGVVEKGGDLRVEVADTNESKELMKFC
RKFTVPLRAALRDAGVLTNYETPKRPVVHIFFIAPGCCYAGYSYTTNNSPFFMGIPRLRF
PADAPSRSTLKLEEAFHVFIPADEWDERLANGMYAVDLGACPGGWTYQLVKRNMWVSSVD
NGPMAQSLMDTGQVTWLREDGFRYRPNRNNISWMVCDMVEKPAKVAALMASWLVNGWCRE
TIFNLKLPMKKRYEEVSQNLAYIQQQLDEHGINAEIQARQLYHDREEVTVHIRRWWAAVG
GRRDER
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgaataaggttgttttatattgtcgcccggggtttgagaaagagtgcgccgcggaaatc
accgataaagcggcgaagcgtgaagtctttggattcgctcgcgtcaaagagaacgcgggc
tatgtggtatttgaatgctatcagcctgatgatgccgacaagctggcgcgcgaactgccg
ttcagctcattgattttcgcccgtcagatgtttgtcgcgggcgaactgctgaaagatctt
ccgccggaagatcgcatcacgccgattgttggcctgttgcagggtgtggtagagaagggc
ggcgatttgcgcgtggaagtggccgacaccaacgaaagcaaagagctgatgaagttctgc
cgtaagttcaccgtgccgctgcgcgcggcgctgcgtgatgcgggtgtgctgacaaactac
gagacgccaaagcgcccggtcgtgcatatcttctttattgcgccaggatgttgctacgcc
ggctactcgtataccaccaataattcgccgttctttatggggatcccgcgtctgcgcttc
ccggcagatgcgccgagccgttcaaccctgaagctggaagaggcgtttcacgtctttatc
ccggcggacgagtgggacgaacgtctggcaaacggcatgtatgccgtcgaccttggcgcg
tgcccgggcggctggacctatcagctggtgaaacgcaatatgtgggtttcgtctgtggat
aacggcccgatggcgcaaagcctgatggataccgggcaggtcacctggctgcgtgaggac
ggcttccgctatcgcccgaaccgcaacaacatctcctggatggtgtgcgacatggtagaa
aaaccggcgaaagtcgcggcgctgatggcctcctggctggtgaacggctggtgtcgtgag
acgattttcaacctcaagctgccgatgaaaaagcgctacgaagaggtgtcgcagaacctg
gcctatattcagcagcagctggacgaacacgggattaacgcggaaatccaggcgcgtcag
ctttatcacgaccgcgaagaagtgacggtccatatccgtcgctggtgggcggcagtgggt
gggcgtcgcgacgagcgataa

DBGET integrated database retrieval system