KEGG   Enterobacter cloacae ECNIH2: ECNIH2_18605Help
Entry
ECNIH2_18605      CDS       T03471                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ecle  Enterobacter cloacae ECNIH2
Pathway
ecle00071  Fatty acid degradation
ecle00280  Valine, leucine and isoleucine degradation
ecle00310  Lysine degradation
ecle00362  Benzoate degradation
ecle00380  Tryptophan metabolism
ecle00620  Pyruvate metabolism
ecle00630  Glyoxylate and dicarboxylate metabolism
ecle00640  Propanoate metabolism
ecle00650  Butanoate metabolism
ecle00900  Terpenoid backbone biosynthesis
ecle01100  Metabolic pathways
ecle01110  Biosynthesis of secondary metabolites
ecle01120  Microbial metabolism in diverse environments
ecle01130  Biosynthesis of antibiotics
ecle01200  Carbon metabolism
ecle01212  Fatty acid metabolism
ecle02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ecle00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ECNIH2_18605
   00630 Glyoxylate and dicarboxylate metabolism
    ECNIH2_18605
   00640 Propanoate metabolism
    ECNIH2_18605
   00650 Butanoate metabolism
    ECNIH2_18605
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ECNIH2_18605
   00072 Synthesis and degradation of ketone bodies
    ECNIH2_18605
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ECNIH2_18605
   00310 Lysine degradation
    ECNIH2_18605
   00380 Tryptophan metabolism
    ECNIH2_18605
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ECNIH2_18605
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ECNIH2_18605
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ECNIH2_18605
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecle04147]
    ECNIH2_18605
Enzymes [BR:ecle01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ECNIH2_18605
Exosome [BR:ecle04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ECNIH2_18605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AIE65319
Position
complement(3862822..3864000)
Genome map
AA seq 392 aa AA seqDB search
MKDVVIVGALRTAIGCFQGALARHSAVDLGSVVVRALVERSGVAAHEIDEVILGQVLTAG
AGQNPARQAALKGGLPNTVSAITINDVCGSGLKALHLATQAIQCGEADVVIAGGQENMSR
APHVLTDSRTGAQLGNSQLLDSLVHDGLWDAFNDYHMGVTAENLAREYGISRELQDAYAL
SSQQKARAAIDSGRFRDEIVPVSTQRQNGEALIVDTDEQPRTDASAEGLAKLDPAFEPLG
SVTAGNASSINDGAAAVMMMSESKAQELALPVLARIKAFASVGVDPALMGIAPVYATRRC
LERAGWELNDVDLIEVNEAFAAQAISVGKMLEWDPLRVNVNGGAIALGHPIGASGCRILV
SLVHEMKKRNARKGIATLCIGGGQGVALAIER
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgtcgttatagtgggtgcgttacgtacggctatcggctgttttcagggagcg
cttgcgcgtcactctgcggttgatcttggcagcgtggtggtaagagcgctggtggaacgc
agcggggttgccgcacatgaaattgatgaggtgatcctgggccaggtgctgaccgctggc
gcgggacaaaaccctgcgcgccaggcggcgctgaagggcggcctgcctaataccgtttcg
gcaattaccattaacgacgtctgtggttcaggtttgaaagcgctccatcttgcaacgcag
gccatccagtgtggtgaagcggatgtggtcattgccggcgggcaggagaatatgagccgt
gccccgcatgtcctgaccgacagccggaccggcgcgcagctcggaaacagccagctgctt
gacagcctggttcacgacgggctgtgggacgccttcaacgactaccatatgggcgtaacg
gcggaaaacctggcgcgggaatacggtatcagccgcgagcttcaggatgcatatgccctc
agctcacagcaaaaagcgcgtgcagcgatcgactccgggcgttttcgcgatgaaattgtc
ccggtcagtacccagcgccagaacggcgaagcgctcatcgtcgataccgacgagcagccg
cgcaccgatgccagcgcagaagggctggcaaaactcgatccggcctttgaaccgctcggt
tccgtaacggcaggcaacgcctcatccattaacgacggtgcggcggcggtgatgatgatg
agtgaaagcaaagcccaggagctggcgctgccggtgctggcgcggattaaagcgtttgcc
agcgtgggcgttgatcccgcgttaatggggatcgccccggtctatgccacgcgccgctgc
ctggagcgggcgggctgggagttgaacgatgtggatctgattgaggtcaacgaagctttt
gctgcacaggcgatctcggtcgggaaaatgctggaatgggatccgctgcgggtcaacgtc
aacggcggagccatcgcgctgggccatcccattggcgcctccggctgccgcattctggtg
tcgctggtccacgaaatgaaaaagcgtaacgcccgaaaagggatcgcaacgctctgtatt
ggcggggggcagggggtggccctggctatcgaacggtaa

DBGET integrated database retrieval system