KEGG   Enterobacter cloacae ECNIH2: ECNIH2_21715Help
Entry
ECNIH2_21715      CDS       T03471                                 

Definition
(GenBank) phosphoenolpyruvate carboxykinase
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
ecle  Enterobacter cloacae ECNIH2
Pathway
ecle00010  Glycolysis / Gluconeogenesis
ecle00020  Citrate cycle (TCA cycle)
ecle00620  Pyruvate metabolism
ecle01100  Metabolic pathways
ecle01110  Biosynthesis of secondary metabolites
ecle01120  Microbial metabolism in diverse environments
ecle01130  Biosynthesis of antibiotics
ecle01200  Carbon metabolism
Module
ecle_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ecle00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECNIH2_21715
   00020 Citrate cycle (TCA cycle)
    ECNIH2_21715
   00620 Pyruvate metabolism
    ECNIH2_21715
Enzymes [BR:ecle01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     ECNIH2_21715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_33
Motif
Other DBs
NCBI-ProteinID: AIE65919
Position
4472966..4474582
Genome map
AA seq 538 aa AA seqDB search
MRVNGLTPQDLKAYGIHDVQEVVYNPDYDTLYQEELNPALEGYERGVLTNLGAIAVDTGI
FTGRSPKDKYIVRDDTTRDTLWWADKGKGKNDNKPLSPETWQHLKGLVTHQLSGKRLFII
DAFCGANADTRLSVRFITEVAWQAHFVKNMFIRPTDEELQDFTPDFIVMNGAKCTNPQWK
EQGLNSENFIAFNLTERIQLIGGTWYGGEMKKGMFSVMNYLLPLRGIASMHCSANVGEKG
DVAVFFGLSGTGKTTLSTDPKRRLIGDDEHGWDDDGVFNFEGGCYAKTIRLSEEAEPDIY
HAIRRDALLENVTVRADGSIDFDDASKTENTRVSYPIYHIENIVKPVSKAGHATKVIFLT
ADAFGVLPPVSRLTASQTQYHFLSGFTAKLAGTERGVTEPTPTFSACFGAAFLSLHPTQY
AEVLVKRMQASGAQAYLVNTGWNGTGKRISIKDTRAIIDAILDGSLDNAETFTLPMFDLA
IPTALPGVDTRILDPRNTYGSPEQWREKAESLAKLFIENFEKYTDTPAGAALVSAGPR
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgttaatggtttaaccccgcaagatctcaaggcttatggtattcacgacgtccag
gaagtggtctacaaccccgattacgatacgctgtatcaggaagagctcaatccggcactg
gaaggatacgagcgcggtgtgttgacgaacctgggtgctatcgccgtcgatacgggtatt
tttaccggtcgttcgcctaaagataagtatatcgtccgagacgacaccacccgcgatacg
ctgtggtgggctgataagggcaaagggaagaacgataacaaaccgctctccccggaaacc
tggcagcatctgaaaggacttgtcacccatcagctttccggcaagcgtctgtttattatt
gatgcgttctgcggcgctaacgccgacacccgtctctccgtacggttcattactgaagtg
gcctggcaggcgcatttcgtgaagaacatgttcattcgtccgaccgatgaagaactgcaa
gacttcacccctgactttatcgtgatgaacggcgcgaaatgcaccaacccgcagtggaaa
gagcagggtctgaactccgaaaacttcatcgccttcaacctgaccgagcgtatccagttg
atcggcggtacctggtacggcggcgaaatgaagaaagggatgttctcagtcatgaactac
ctgctgccgctgcgcggtatcgcctccatgcactgctcggcgaacgtcggggaaaaaggc
gatgtagcagtgttcttcggcctttccggcaccggtaaaacaacgctgtccaccgatcca
aaacgtcgtctgattggcgacgatgaacacggctgggatgatgacggcgtgtttaacttt
gaaggcggctgctacgcgaagaccattcgcctgtcggaagaggcagagccggatatctac
cacgcgattcgccgcgatgcgctgctggaaaacgtcaccgtgcgtgccgatggttctatc
gacttcgacgatgcctcgaaaacggaaaacacccgcgtctcttacccgatctaccacatc
gagaacatcgtcaagccggtatcgaaggcgggtcatgccacgaaggtgattttcctgacc
gcggatgcgttcggcgtgctgccaccggtttcccgcctgaccgccagccagacgcagtac
catttcctctccggctttaccgctaaactggcgggtaccgagcgcggtgtgaccgagcca
accccaaccttctccgcctgcttcggcgcggcgttcctgtcgctgcacccaacgcagtac
gcggaagtgctggtgaaacgcatgcaggcatccggcgcccaggcgtacctggtgaacacc
ggctggaacggtacgggcaaacgtatctccatcaaagatacacgcgccatcatcgacgcg
attctggatggttcgctggataacgctgagacctttacgctgccgatgttcgatctggcg
atcccaacagcactgccgggcgtggatacgcgtatcctggatccgcgtaacacctacggt
tcaccggaacagtggcgtgagaaggctgaatcgctggcgaaactgtttatcgaaaacttc
gagaagtataccgacaccccggccggtgctgcgctggtgagtgcgggaccaaggtaa

DBGET integrated database retrieval system