KEGG   Enterobacter cloacae ECNIH2: ECNIH2_22525Help
Entry
ECNIH2_22525      CDS       T03471                                 

Definition
(GenBank) glycyl-tRNA synthetase
  KO
K01878  glycyl-tRNA synthetase alpha chain [EC:6.1.1.14]
Organism
ecle  Enterobacter cloacae ECNIH2
Pathway
ecle00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:ecle00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    ECNIH2_22525
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ecle01007]
    ECNIH2_22525
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ecle03016]
    ECNIH2_22525
Enzymes [BR:ecle01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     ECNIH2_22525
Amino acid related enzymes [BR:ecle01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   ECNIH2_22525
Transfer RNA biogenesis [BR:ecle03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    ECNIH2_22525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2e
Motif
Other DBs
NCBI-ProteinID: AIE66070
Position
complement(4660935..4661846)
Genome map
AA seq 303 aa AA seqDB search
MQKFDTKTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTSLRALGPEPMATAYVQ
PSRRPTDGRYGENPNRLQHYYQFQVVIKPSPDNIQELYLGSLKELGMDPTIHDIRFVEDN
WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPITGEITYGLERLAMYIQGVDSV
YDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEYADVDFLFTCFEQYEKEAQQLLALETPL
PLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRTLTKAVAEAYYASREALGFPMCN
RNK
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagtttgataccaagaccttccagggcctgatcctgaccttacaggattactgg
gctcgtcagggctgcaccattgttcaacctttggacatggaagttggcgcaggcacctca
cacccgatgaccagcctgcgcgcgttagggccagagccaatggcgaccgcctatgtgcag
ccatcccgtcgtccgaccgatggccgttacggcgaaaacccgaaccgtttgcagcactac
tatcagttccaggtggtgattaagccatcacccgacaacattcaggaactgtacctcggg
tcactgaaagagctgggtatggatccaaccattcacgacattcgtttcgtggaagataac
tgggaaaacccaacgctgggtgcctggggtctgggttgggaagtgtggctgaacggcatg
gaagtgacccagttcacttacttccagcaggttggcggtctggaatgtaaaccgattacc
ggcgaaatcacctatggtctggaacgtctggccatgtacattcagggcgtagacagcgtt
tacgacctggtctggagcgacggcccgctgggtaaaaccacctacggcgacgtgttccat
cagaacgaagtggagcaatccacctataacttcgaatacgcggacgtggacttcctgttc
acctgcttcgagcagtacgagaaagaagcccagcagctgctggcgctggagactccgctg
ccgctgcctgcctacgagcgtattctgaaggctgcccacagcttcaacctgctggatgcc
cgcaaagcgatctccgtgactgaacgtcagcgctacattctgcgtattcgtaccctgacc
aaagccgttgcagaagcttactacgcgtcccgtgaagcccttggcttcccgatgtgcaac
cgaaacaaataa

DBGET integrated database retrieval system