KEGG   Enterobacter cloacae GGT036: EC036_06780Help
Entry
EC036_06780       CDS       T03429                                 

Definition
(GenBank) cobalt transporter
  KO
K06195  ApaG protein
Organism
eclg  Enterobacter cloacae GGT036
Brite
KEGG Orthology (KO) [BR:eclg00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    EC036_06780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: AIV28325
UniProt: A0A0M7CJA0
Position
complement(738021..738398)
Genome map
AA seq 125 aa AA seqDB search
MIDSPRVCVQVQSVYVESQSSPDEERFVFAYTVTIRNLGRMPVQLLGRYWLITNGNGREI
EVQGEGVVGEQPHIAPGEEYQYTSGAVIETPLGTMQGHYEMVDVDGNVFRVAIPVFRLAV
TTLIH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgattgattcgccccgcgtctgtgtccaggtacaaagcgtttacgttgagtcgcagtcc
tcacccgatgaagaacgttttgttttcgcctacaccgtgaccattcgcaacctggggcgg
atgcctgtgcaactgctcgggcgttactggcttatcactaacggcaatggccgtgaaatc
gaagttcagggtgaaggtgtggttggtgaacagccccacatcgcccctggcgaagagtat
cagtacaccagcggtgcagtaattgaaacaccgctgggtaccatgcaaggccattatgaa
atggtcgacgtcgatggcaatgtgttccgcgttgctattcctgtgttccgtctcgccgtt
acaacactcattcattaa

DBGET integrated database retrieval system