KEGG   Enterobacter cloacae GGT036: EC036_17250Help
Entry
EC036_17250       CDS       T03429                                 

Definition
(GenBank) selenophosphate synthetase
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
eclg  Enterobacter cloacae GGT036
Pathway
eclg00450  Selenocompound metabolism
eclg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eclg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    EC036_17250
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:eclg03016]
    EC036_17250
Enzymes [BR:eclg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     EC036_17250
Transfer RNA biogenesis [BR:eclg03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    EC036_17250
 Prokaryotic Type
    EC036_17250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: AIV29372
UniProt: A0A427KMZ8
Position
1866950..1867993
Genome map
AA seq 347 aa AA seqDB search
MSEQTIRLTQYSHGAGCGCKISPKVLETILHSEQAKFVDPNLLVGNETRDDAAVYDLGNG
TSIISTTDFFMPIVDNPFDFGRIAATNAISDIFAMGGKPIMAIAILGWPINTLAPEIARQ
VIEGGRFACQQAGIALAGGHSIDAPEPIFGLAVTGVVPTERVKRNSTAQAGCKLFLTKPL
GIGVLTTAEKKSLLKPEHKGLATEVMCQMNLAGAAFANIDGVKAMTDVTGFGLLGHLSEV
CQGAGVQAQVWYQDVPKLPGVEAYIAQGAVPGGTQRNFASYGHLMGEMPEEWRNLLCDPQ
TSGGLLLAVTPESEAEVQATAAEFGITLTAIGELVTARGGRPMIEIR
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagcaaaccattcgtttaacgcaatacagccacggagccggttgcggttgtaaa
atttcccccaaagtgctggaaaccatcctgcacagcgaacaggcgaagtttgtcgacccg
aacctgcttgttggcaacgaaacgcgtgacgatgcagcggtttatgacttgggtaacggc
accagcattatcagtaccactgacttctttatgccgattgtcgataacccgttcgatttt
gggcgcatcgcggcgaccaacgccatcagcgatatcttcgcgatgggcggtaaaccgatt
atggcgattgcgattctgggctggccgatcaacaccctggcgccagaaatagcccgccag
gtgattgagggcggacgctttgcctgccagcaggcggggattgccctggccggtggtcac
tctattgatgcgccggagccgatcttcggtctggcggtcacgggcgtggtgcctaccgag
cgcgtcaaacgcaacagcaccgcgcaggcgggttgcaagctgttcctcaccaagccgctg
ggcattggcgtactgaccactgccgagaaaaaatccctgctgaaaccggaacacaaaggt
ctggcaacggaagtgatgtgccagatgaacctggccggtgccgctttcgccaatatcgac
ggcgtgaaggcgatgaccgacgtcaccggttttggcctgttggggcatctctctgaagtg
tgtcagggcgcgggtgtgcaggcgcaggtctggtatcaggacgtgccgaagctgccaggc
gtggaagcgtacattgcccagggcgccgtgccgggcggtactcagcgtaactttgccagc
tatggtcatctgatgggcgaaatgcctgaagagtggcgtaacctgctgtgcgatccgcaa
acctcgggtggtctgctgctggcagtcacgccggagtcagaagccgaggtgcaggcaacg
gccgccgagtttggtattaccctgacggcgatcggcgaactggtgaccgcgcgcggtggc
cgaccgatgattgagatccgttaa

DBGET integrated database retrieval system