KEGG   Enterobacter cloacae GGT036: EC036_18990Help
Entry
EC036_18990       CDS       T03429                                 

Definition
(GenBank) dihydromonapterin reductase
  KO
K13938  dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.50 1.5.1.3]
Organism
eclg  Enterobacter cloacae GGT036
Pathway
eclg00670  One carbon pool by folate
eclg00790  Folate biosynthesis
eclg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eclg00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    EC036_18990
   00670 One carbon pool by folate
    EC036_18990
Enzymes [BR:eclg01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     EC036_18990
    1.5.1.50  dihydromonapterin reductase
     EC036_18990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase
Motif
Other DBs
NCBI-ProteinID: AIV29546
Position
complement(2052413..2053135)
Genome map
AA seq 240 aa AA seqDB search
MGTAQHRPILITGGGRRIGLALAHHFLNLRHPVIVSYRTEYPSIDGLRKGGATCIQADFS
TDDGILAFADKVKSTTHGLRAIIHNASAWLAEKPGTSLSETLACMLQIHVNAPYLLNHAL
QDLLRGHGHAAGDIIHFTDYVVERGSDKHIAYAASKAALDNMTRSFARKLAPEVKVNAIA
PAMILFNEGDDAEYRQQALNKSLMKIAPGEKEVIDLIDYLLTSCYVTGRTFAVDGGRPLR
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgggaactgcgcagcatcgcccaatactgatcaccggtggaggccgtcgtatcggcctc
gccctcgcccatcactttctcaaccttcgccacccggtcattgtcagttaccgcacggaa
tacccctcgatagacgggctacgaaaagggggggcaacctgtattcaggctgatttctcc
accgacgacggcattcttgcctttgcggataaggtcaaatcaacgacccacggtctgcgg
gcgattatccataacgccagcgcatggcttgcagaaaaacccggtacgtcgctcagcgaa
acgctcgcctgtatgctgcagatccacgtcaatgccccctatttgcttaaccatgccctg
caggatctgctgcgcggccacggccatgccgcgggtgacattattcatttcaccgattat
gtggtggagcgcgggagcgacaaacacatcgcttatgcggcgagtaaagctgcactggat
aacatgacgcgttcatttgcccgcaagctggcaccagaggtcaaggtgaacgccatcgcc
ccggcgatgattttattcaacgagggcgatgatgccgagtatcgtcagcaggcgctgaat
aaatccctgatgaaaatcgcccctggcgagaaagaggtgatcgaccttatcgattatctg
ctcaccagctgttacgtcaccggcagaacctttgccgtggacggcgggcgaccgctgcgc
tag

DBGET integrated database retrieval system