KEGG   Enterobacter cloacae GGT036: EC036_22000Help
Entry
EC036_22000       CDS       T03429                                 

Definition
(GenBank) 3,4-dihydroxybenzoate decarboxylase
  KO
K22958  gallate decarboxylase subunit C [EC:4.1.1.59]
Organism
eclg  Enterobacter cloacae GGT036
Pathway
eclg00627  Aminobenzoate degradation
eclg01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eclg00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    EC036_22000
Enzymes [BR:eclg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.59  gallate decarboxylase
     EC036_22000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UbiD
Motif
Other DBs
NCBI-ProteinID: AIV29847
Structure
PDB: 

Position
2388992..2390479
Genome map
AA seq 495 aa AA seqDB search
MQNPINDLRSAIALLQRHPGHYIETDHPVDPNAELAGVYRHIGAGGTVKRPTRTGPAMMF
NSVKGYPGSRILVGMHASRERAALLLGCEPSKLAQHVGQAVKNPVAPVVVPASQAPCQEQ
IFYADDPDFDLRKLLPAPTNTPIDAGPFFCLGLVLASDPEDTSLTDVTIHRLCVQERDEL
SMFLAAGRHIEVFRKKAEEVGKPLPVTINMGLDPAIYIGACFEAPTTPFGYNELGVAGAL
RQQPVELVQGVAVKEKAIARAEIIIEGELLPGVRVREDQHTNTGHAMPEFPGYCGEANPS
LPVIKVKAVTMRNHAILQTLVGPGEEHTTLAGLPTEASIRNAVEEAIPGFLQNVYAHTAG
GGKFLGILQVKKRQPSDEGRQGQAALIALATYSELKNIILVDEDVDIFDSDDILWAMTTR
MQGDVSITTLPGIRGHQLDPSQSPDYSTSIRGNGISCKTIFDCTVPWVLKARFERAPFME
VDPTPWAPELFSDKK
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaccccatcaacgatctcagaagcgccatcgcgttgctgcaacgccatccaggt
cactatatcgaaaccgatcacccggtagatcccaatgctgaactggcgggcgtctaccgc
catatcggcgcgggcggtaccgtaaaacgccccacccgcacgggcccggccatgatgttc
aatagcgtgaagggctaccccggctcccgcatcctggtaggtatgcacgccagccgggaa
agagcggcgcttctgctgggttgtgaaccctcgaagctggcgcagcacgttggtcaggcg
gtgaaaaacccggttgcaccggtggtggttccggcctcgcaggcaccgtgccaggagcag
atcttttacgccgacgatccggactttgacctgcgtaagctgcttccggccccgaccaac
acgccaattgatgcaggcccgttcttctgtctggggctggtactggcaagcgatccggaa
gatacctcgctgaccgatgtgaccattcaccgtctctgtgtgcaggagcgagatgaactc
tctatgttccttgccgccggtcgccatatcgaagtttttcgcaagaaggccgaagaggtg
ggcaaaccgctgccggtaaccatcaatatgggacttgacccggctatctacattggggcc
tgtttcgaagcgccaaccacgcccttcggttacaacgagcttggcgtcgccggggcatta
cgccagcaaccggtggagctggtacagggcgtggcggtaaaagagaaagcgatcgcgcgg
gcggaaatcatcatcgagggcgaactgcttcccggcgtgcgcgtaagagaagatcagcac
accaacaccggccacgccatgccggagttcccgggctactgcggcgaggcgaatccgtct
ctgccggtgatcaaagtgaaagccgtgacgatgcgaaaccacgcgatcctgcagacgctg
gtgggcccgggcgaagagcacaccacgcttgccggtttgccgaccgaggccagtattcgc
aacgcggtcgaagaggccattcccggctttctgcaaaacgtttacgcccacaccgccgga
ggcggtaaatttctcggcattttacaggtgaaaaaacgccagccgtcagacgaaggacgt
cagggccaggcggcacttatcgccctggccacctattccgagctgaaaaacattatcctc
gtggatgaagacgtggatatcttcgacagcgacgacatcctgtgggcaatgaccacccgc
atgcagggcgatgtgagcattaccacgcttccggggatccgcggccaccagctggatccg
tcgcagtcgccggactacagcacctcgatccgtggaaacggcatttcctgcaagactatc
ttcgactgcacggtgccgtgggtgctgaaggcgcggtttgaacgtgcgccgttcatggag
gttgatcccacaccgtgggcgccggagctgttcagcgataaaaaatag

DBGET integrated database retrieval system