KEGG   Enterobacter cloacae GGT036: EC036_35990Help
Entry
EC036_35990       CDS       T03429                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
eclg  Enterobacter cloacae GGT036
Pathway
eclg00071  Fatty acid degradation
eclg00072  Synthesis and degradation of ketone bodies
eclg00280  Valine, leucine and isoleucine degradation
eclg00310  Lysine degradation
eclg00362  Benzoate degradation
eclg00380  Tryptophan metabolism
eclg00620  Pyruvate metabolism
eclg00630  Glyoxylate and dicarboxylate metabolism
eclg00640  Propanoate metabolism
eclg00650  Butanoate metabolism
eclg00900  Terpenoid backbone biosynthesis
eclg01100  Metabolic pathways
eclg01110  Biosynthesis of secondary metabolites
eclg01120  Microbial metabolism in diverse environments
eclg01130  Biosynthesis of antibiotics
eclg01200  Carbon metabolism
eclg01212  Fatty acid metabolism
eclg02020  Two-component system
Brite
KEGG Orthology (KO) [BR:eclg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    EC036_35990
   00630 Glyoxylate and dicarboxylate metabolism
    EC036_35990
   00640 Propanoate metabolism
    EC036_35990
   00650 Butanoate metabolism
    EC036_35990
  09103 Lipid metabolism
   00071 Fatty acid degradation
    EC036_35990
   00072 Synthesis and degradation of ketone bodies
    EC036_35990
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EC036_35990
   00310 Lysine degradation
    EC036_35990
   00380 Tryptophan metabolism
    EC036_35990
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    EC036_35990
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    EC036_35990
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    EC036_35990
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:eclg04147]
    EC036_35990
Enzymes [BR:eclg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     EC036_35990
Exosome [BR:eclg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EC036_35990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AIV31246
Position
complement(3916163..3917365)
Genome map
AA seq 400 aa AA seqDB search
MSFNAEVVMKDVVIVGALRTAIGCFQGALARHSAVELGSVVVKALVERSGIPAHEVDEVI
LGQVLTAGAGQNPARQAALKGGLPNTVSAITINDVCGSGLKALHLATQAIQCGEADVVIA
GGQENMSRAPHVLTDSRTGAQLGNSQLLDSLVHDGLWDAFNDYHMGVTAENLAREYGISR
ELQDAYALSSQQKARAAIDSGRFRDEIVPVCTQRQNGQTIVVDTDEQPRTDASAEGLAML
NPAFETQGSVTAGNASSINDGAAAVMMMSESKAQELDLPVLARIKAFASVGVDPALMGIA
PVYATRRCLDRAGWQLSDVDLIEVNEAFAAQAISVGKMLEWDPLRVNVNGGAIALGHPIG
ASGCRILVSLVHEMKKRNARKGIATLCIGGGQGVALAIER
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtcctttaacgcagaggtggtgatgaaagatgtcgttatagtgggtgcgttgcgtaca
gctatcggctgttttcagggagcgctggcgcgtcactcggctgttgaactgggtagcgtg
gtggtgaaagcgctggtggagcgcagcgggatcccggcacatgaagtcgatgaggtgatc
ctcggacaggtcctgacggccggcgccgggcaaaaccctgcccgtcaggcggcgctaaaa
ggcggcctgcccaacaccgtctcggcaatcaccatcaacgacgtctgtggctcagggtta
aaggcgctgcatcttgccacgcaggccatccagtgtggcgaagcggatgtggtcattgcc
ggtgggcaggagaacatgagccgcgcgccgcatgtcctcaccgacagccgcaccggcgcg
cagctgggtaacagccagctgctcgacagcctggtgcatgacgggctgtgggacgcgttt
aatgattatcatatgggcgtgacggcggaaaacctggcgcgtgagtacggtataagccgt
gagctgcaggatgcttacgcgttgagctcgcagcagaaagcgcgtgccgcgattgattcc
gggcgttttcgcgatgaaattgtcccggtgtgcacccagcgccagaacggtcagacgatt
gtcgtcgacaccgatgagcagccgcgaaccgatgccagcgcagaagggctggccatgctc
aatcctgcttttgaaacgcaagggtcggtcacggcgggaaatgcctcttcgattaacgac
ggtgcggcagcggtgatgatgatgagcgaaagcaaagcgcaggaactggatctccccgtg
ctggcccgaattaaggcgtttgccagcgtgggggttgatccggcgttaatggggatcgcg
ccggtgtatgcgacccgccgctgcctggatcgcgcgggctggcagctttccgatgtggat
ctgatcgaagtcaacgaggcctttgccgcgcaggcgatctcagtgggcaaaatgctggag
tgggatccgctgcgggtgaatgtcaacggcggtgcgattgcgctcggtcatcccatcggt
gcttcgggctgccgcattctggtatcgctggttcacgagatgaaaaagcgtaacgcccgt
aaaggcattgccacgctctgtatcggcggtgggcaaggagtagcgctggctatcgaacgt
taa

DBGET integrated database retrieval system