KEGG   Enterobacter cloacae GGT036: EC036_37390Help
Entry
EC036_37390       CDS       T03429                                 

Definition
(GenBank) sensor protein QseC
  KO
K07645  two-component system, OmpR family, sensor histidine kinase QseC [EC:2.7.13.3]
Organism
eclg  Enterobacter cloacae GGT036
Pathway
eclg02020  Two-component system
eclg02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:eclg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    EC036_37390
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    EC036_37390
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:eclg01001]
    EC036_37390
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:eclg02022]
    EC036_37390
Enzymes [BR:eclg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     EC036_37390
Protein kinases [BR:eclg01001]
 Histidine kinases
  OmpR family
   EC036_37390
Two-component system [BR:eclg02022]
 OmpR family
  QseC-QseB (quorum sensing)
   EC036_37390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA 2CSK_N HAMP
Motif
Other DBs
NCBI-ProteinID: AIV31386
Position
4057234..4058571
Genome map
AA seq 445 aa AA seqDB search
MKLSLKLRLTLLFLLLSLTAWFAASLVAWQQTTHKLDKLFDTQQMLFAKRLLTMDLDEIR
APERMHEIPKKVKHGRLDDDALAFAIYATDGTMILNDGENGRDIPYHYRRDGFDDGRLKD
DNDDWRFLWLTSPDGKYRVVVGQEWEYRQEMALDVVSSQLTPWLVALPVMLLLLIVLLSR
ELKPLKKLAQTLRLRSPDATDTLPTQGVPSEVRPLLDSLNHLFTRTQEMMSRERRFTSDA
AHELRSPLAALKVQTDVAQLSLDDPQAQEKALSQLHAGIDRASRLVDQLLTLSRLDSLEN
LDDVEPIKMADLLQSAVLDIWHPAQQAGIDVRLNINAPQAERTGQPLLLSLLVRNLLDNA
VRYSPRGSVVDVTLDARCFSVRDNGPGIAPEALARIGERFYRPPGQDATGSGLGLSIVKR
IAALHAMRVSLDNAAEGGVDVKVCW
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgagcctgaaactccgtctgacgcttctttttctgctgctgtcgctgacggcc
tggtttgccgcaagccttgtcgcctggcagcagacgacccacaagctcgataagctgttt
gatacccagcagatgctgtttgctaaacggctgctgacgatggatctggatgaaatacgc
gctccggagcggatgcacgagatccccaaaaaagtgaagcacggtcgcctggacgacgat
gctctggccttcgccatttacgctaccgacggtacgatgatcctcaatgacggggaaaac
ggccgcgacatcccgtatcactatcgccgcgatgggtttgatgacggcaggctcaaagac
gacaacgatgactggcgtttcttatggctgacctcgccggacgggaagtaccgcgtggtg
gtcggtcaggagtgggaataccggcaggagatggcgctggatgtggtcagctcgcagctg
acgccgtggctggtggcgctaccggtgatgctgctgttgctgattgtcctgctgagccgg
gagcttaagccattgaaaaaactggctcagacgttgcgccttcgctcaccggatgccacc
gacactctgccgacacagggcgtgccatcagaagtgcgcccccttctggactccctgaac
cacctctttacccgaacccaggagatgatgagccgcgagcgccgctttacctccgatgcc
gcgcacgaattacgtagcccgctggcggccctgaaggtgcaaaccgacgtggcgcaactc
tctctggacgacccgcaggcgcaggaaaaagcgctctcgcagctccacgcggggatcgac
cgggcatcccggctggtggatcaactcctcactctctcgcgtctggactctctggaaaat
ctcgacgatgtcgaaccgataaagatggccgatttactgcaatcagcggttctggacatc
tggcatccggcgcagcaggcgggtatcgacgttcgcctgaacatcaacgccccgcaggct
gaacgcacgggtcaaccgctgctgttgagcctgctggtgcgtaacctgctggataacgcc
gttcgttacagcccgcgcggcagcgtggttgacgttacgctggacgcccgttgcttctcc
gtacgcgacaacggaccagggatcgcccccgaggcgttggcccgtattggcgagcgtttt
tatcgtccacccggccaggatgccacgggcagcgggctggggttatcgattgtaaaacgc
attgctgccctgcacgctatgcgcgtttcactggataatgctgcggaaggcggcgttgat
gtgaaggtgtgctggtaa

DBGET integrated database retrieval system