KEGG   Enterobacter cloacae GGT036: EC036_40650Help
Entry
EC036_40650       CDS       T03429                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
eclg  Enterobacter cloacae GGT036
Pathway
eclg03010  Ribosome
Brite
KEGG Orthology (KO) [BR:eclg00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    EC036_40650
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:eclg03011]
    EC036_40650
Ribosome [BR:eclg03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    EC036_40650
  Bacteria
    EC036_40650
  Archaea
    EC036_40650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AIV31712
UniProt: A0A0F1PNH1
Position
complement(4397564..4397896)
Genome map
AA seq 110 aa AA seqDB search
METLAQHRHARSSAQKVRLVADLIRGKKVSQALDILTYTNKKAAVLVKKVLESAIANAEH
NDGADIDDLKVAKIFVDEGPSMKRIMPRAKGRADRILKRTSHITVVVSDR
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaaactttagctcaacatcgccatgctcgttcttctgcacagaaggttcgccttgtt
gctgacctgattcgcggtaagaaagtgtcgcaggccctggacatcctgacctataccaac
aagaaagctgcggtattggtcaagaaagtactggaatctgccattgctaacgctgaacac
aacgatggcgctgacatcgacgatctgaaagtcgcgaaaattttcgtagatgaaggccca
agcatgaagcgcattatgccgcgtgcgaaaggtcgtgcagatcgcatcctgaagcgcacc
agccacattactgtggttgtgtccgatcgctga

DBGET integrated database retrieval system